KEGG   Mus musculus (mouse): 12569
Entry
12569             CDS       T01002                                 

Gene name
Cdk5r1, Cdk5r, D11Bwg0379e, p2, p25, p3, p35
Definition
(RefSeq) cyclin-dependent kinase 5, regulatory subunit 1 (p35)
  KO
K11716  cyclin-dependent kinase 5 activator 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12569 (Cdk5r1)
   05022 Pathways of neurodegeneration - multiple diseases
    12569 (Cdk5r1)
  09165 Substance dependence
   05030 Cocaine addiction
    12569 (Cdk5r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12569 (Cdk5r1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    12569 (Cdk5r1)
SSDB
Motif
Pfam: CDK5_activator MTBP_C
Other DBs
NCBI-GeneID: 12569
NCBI-ProteinID: NP_034001
MGI: 101764
Ensembl: ENSMUSG00000048895
Vega: OTTMUSG00000000218
UniProt: P61809 Q542T9
Position
11 B5; 11 47.94 cM
AA seq 307 aa
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
VSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
NT seq 924 nt   +upstreamnt  +downstreamnt
atgggcacggtgctgtccctatcccccagctatcggaaggccacactgtttgaggatggc
gcggccaccgtgggccactacacggccgtgcagaacagcaagaacgccaaggacaagaac
ctgaagcggcactccatcatctcggtgctgccttggaagaggatcgtggcggtgtcagcg
aagaagaagaactccaagaaggcgcagcccaacagcagctaccagagcaacatcgcgcat
ctcaacaatgagaacctgaagaagtcgctgtcctgtgccaacctgtccacattcgcccag
cccccgccggctcagccgcccgcacccccagccagccagctttctggctcccagactggg
gtctcctcttctgtcaagaaggccccgcaccctgccatcacctctgcagggacacccaaa
cgggtcatcgtccaggcgtccactagtgagctgctgcgctgcctgggtgagtttctctgc
cgccggtgctaccgcctgaagcacttgtccccaacggaccccgtgctctggctgcgcagc
gtggaccgctccctgcttctgcagggctggcaggaccagggtttcatcacaccggccaat
gtggtcttcctctacatgctctgcagggatgtcatctcctctgaggtgggctccgaccat
gagctccaggctgtcctgctgacctgtctgtacctctcctattcctacatgggcaatgag
atctcctacccgctcaagcccttcctggtagagagctgtaaggaagccttttgggaccgt
tgcctctcagttatcaacctcatgagctccaagatgctgcagatcaatgccgacccacac
tatttcacacaagtgttctctgacttgaagaatgagagcggtcaggaggacaagaagcga
ctcctcctggggctggatcggtga

DBGET integrated database retrieval system