KEGG   Mus musculus (mouse): 12570
Entry
12570             CDS       T01002                                 

Gene name
Cdk5r2, B230310J22Rik, p3, p39
Definition
(RefSeq) cyclin-dependent kinase 5, regulatory subunit 2 (p39)
  KO
K19929  cyclin-dependent kinase 5 activator 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12570 (Cdk5r2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    12570 (Cdk5r2)
SSDB
Motif
Pfam: CDK5_activator
Other DBs
NCBI-GeneID: 12570
NCBI-ProteinID: NP_034002
MGI: 1330828
Ensembl: ENSMUSG00000090071
Vega: OTTMUSG00000034759
UniProt: O35926
Position
1; 1 C4
AA seq 369 aa
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDGPDGGGTAKP
LAVPVPTVPTTAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAPQAAPPAPGGSPRRVIVQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASTGGPPSGSSASTTSSSSARDSCATGA
KHWTMNLDR
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgggcacggtgctgtcgctttcccctgcttcctcggccaagggccggaggccgggaggg
ctgccggaggagaaaaagaaggcgccgcccgcgggggacgaggcgctggggggctacggc
gcgccgccggccggcaagggcggcaaaggcgagagccggctcaaacggccgtccgtgctc
atctcggcgctcacctggaagcgcctagtggcagcctcggccaagaagaagaaaggcagc
aaaaaggtgacgcccaagccagcgtccaccggtcccgaccctctggtccagcaacgcaac
cgcgagaaccttctccgcaagggccgcgacggccccgacggtggcggaacagccaagccc
ctggccgtgccggtgcccacggtgcccacgaccgctgccacctgcgagcccccgtcgggg
ggcagcgcagccgcccctccaccaggctcaggcgggggaaagccgccgccgccgccaccc
ccagccccgcaggcggcaccgccggcgcccggaggctcgccgcggcgggtcatcgtgcag
gcgtctaccggcgagctgctccgctgcctcggcgacttcgtgtgccgacgctgctaccgc
ctcaaggagctgagccccggcgagctggtgggctggttccgcggcgtggaccgctcgctg
ctgctgcagggctggcaagaccaggccttcattacccccgccaacctggtgttcgtgtac
ctgctgtgccgggagtcgcttcgtggggacgagctggcgtcggccgcggaactgcaggcc
gccttcctcacctgcctctacctcgcctactcctacatgggcaacgagatctcctacccg
ctcaagccgttcctcgtggagcccgacaaggagcgcttctggcagcgctgcctgcgcctc
atccagcggctcagcccgcagatgctgcgactcaacgccgacccccacttcttcacgcaa
gtctttcaagacctcaagaacgagggcgaggccgcggcgagcaccgggggtccaccgagc
ggaagcagcgcgtccaccacctcctcctcgagcgccagggacagctgcgcgaccggagcc
aagcactggactatgaacttggaccgctag

DBGET integrated database retrieval system