KEGG   Mus musculus (mouse): 12572
Entry
12572             CDS       T01002                                 

Gene name
Cdk7, AI323415, AI528512, C230069N13, Cdkn7, Crk4
Definition
(RefSeq) cyclin-dependent kinase 7
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    12572 (Cdk7)
  09124 Replication and repair
   03420 Nucleotide excision repair
    12572 (Cdk7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12572 (Cdk7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12572 (Cdk7)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    12572 (Cdk7)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    12572 (Cdk7)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12572 (Cdk7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12572 (Cdk7)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     12572 (Cdk7)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   12572 (Cdk7)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     12572 (Cdk7)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     12572 (Cdk7)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     12572 (Cdk7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 APH Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 12572
NCBI-ProteinID: NP_034004
MGI: 102956
Ensembl: ENSMUSG00000069089
UniProt: Q03147 Q3THG5
Position
13 D1; 13 53.23 cM
AA seq 346 aa
MAVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGVPLQHIFIAAGDDLLELIQGLFLFNPCTRTTASQALKTKYFSNRPG
PTPGCQLPRPNCPVEALKEPANPTVATKRKRAEALEQGILPKKLIF
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggctgtggacgtgaagtctcgagcgaagcgctatgagaaactggacttcctcggagag
ggacagtttgcgacggtctataaggccagggacaagaacaccaaccaaatcgtcgccatt
aagaaaatcaaacttggacacaggtcagaagctaaggatggaataaatagaacagcctta
agggagataaagctcttacaggaactaagtcatccaaatataattggtctccttgatgca
tttggacataagtctaacattagccttgtctttgattttatggaaactgacctcgaggtt
attataaaggataacagccttgtgctgacaccatcccacattaaagcctacatgttgatg
actcttcagggcttagaatatttacatcagcattggattctacacagggatctgaaacca
aacaacttgttgttagatgagaatggagttctgaaactggcagattttggcctggccaaa
tcatttgggagccccaatagggcttacacacatcaagttgtgaccagatggtaccgggct
cctgagttattgtttggagctaggatgtatggtgtgggagtagacatgtgggctgttggt
tgtatattagcagaattgcttctaagggttccatttttgcctggagattcagatcttgat
cagctaacaaggatatttgaaactctgggtacaccaactgaagagcagtggcctgacatg
tgtagtcttcccgattatgtgacatttaagagtttccctggggtcccactgcagcacatc
ttcatcgcggctggggacgacctgctggagctcatccaaggcctgttcttatttaacccg
tgtacgcggaccacagcctcacaggcattgaagaccaagtacttcagtaaccgccccggg
ccaacacctggatgccagctcccgcgaccaaactgtccggtggaggcattaaaggaaccg
gcgaatccaaccgtggcaacaaagcggaaaagagcagaggccttagaacaaggaatattg
cccaagaagctcattttttag

DBGET integrated database retrieval system