KEGG   Mus musculus (mouse): 12579Help
Entry
12579             CDS       T01002                                 

Gene name
Cdkn2b, AV083695, INK4b, MTS2, p15, p15(INK4b), p15INK4b
Definition
(RefSeq) cyclin dependent kinase inhibitor 2B
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
mmu04934  Cushing syndrome
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05222  Small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12579 (Cdkn2b)
   04068 FoxO signaling pathway
    12579 (Cdkn2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12579 (Cdkn2b)
   04218 Cellular senescence
    12579 (Cdkn2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12579 (Cdkn2b)
   05203 Viral carcinogenesis
    12579 (Cdkn2b)
  09162 Cancer: specific types
   05226 Gastric cancer
    12579 (Cdkn2b)
   05222 Small cell lung cancer
    12579 (Cdkn2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12579 (Cdkn2b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12579 (Cdkn2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 12579
NCBI-ProteinID: NP_031696
MGI: 104737
Ensembl: ENSMUSG00000073802
UniProt: P55271 Q549R4
Structure
PDB: 

Position
4 C4; 4 42.15 cM
AA seq 130 aa AA seqDB search
MLGGSSDAGLATAAARGQVETVRQLLEAGADPNALNRFGRRPIQVMMMGSAQVAELLLLH
GAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVCDAWGRLPVDLAEEQGHRDI
ARYLHAATGD
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcggcagcagtgacgcgggcctggccaccgccgcggcgcgggggcaagtggag
acggtgcggcagctcctggaagccggcgcagatcccaacgccctgaaccgcttcgggagg
cgcccaatccaggtcatgatgatgggcagcgcccaggtggcagagctgctgctgctccac
ggagcagaacccaactgcgccgaccctgccacccttaccagacctgtgcacgacgcagct
cgggaaggcttcctggacacgcttgtcgtgctgcaccgggcaggggcgcggctggatgtg
tgtgacgcctggggccgcctgccggtagacttggctgaagagcagggccaccgtgacatt
gcgaggtatctgcacgctgccactggagattga

DBGET integrated database retrieval system