KEGG   Mus musculus (mouse): 12581Help
Entry
12581             CDS       T01002                                 

Gene name
Cdkn2d, INK4d, p19, p19INK4d
Definition
(RefSeq) cyclin dependent kinase inhibitor 2D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    12581 (Cdkn2d)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12581 (Cdkn2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 12581
NCBI-ProteinID: NP_034008
MGI: 105387
Ensembl: ENSMUSG00000096472
Vega: OTTMUSG00000063300
UniProt: Q60773 Q3US51
Structure
PDB: 

Position
9; 9 A3
AA seq 166 aa AA seqDB search
MLLEEVCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALEL
LKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHS
SVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIPM
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggaagaagtctgcgtcggcgaccggttgagtggcgcagcggcccgtggcgac
gtgcaagaggtccgccgccttcttcaccgggagctggtgcatcctgacgccctgaaccgc
tttggcaagacggccttgcaggtcatgatgtttggaagtccagcagttgctttggagctc
ctgaagcaaggtgccagccccaatgtccaagatgcctccggtactagtcctgtgcatgat
gcggctcgcaccgggttcctggacaccctgaaggttctggtggagcatggtgctgatgtc
aatgccctggacagcactgggtcgctccccatccatctggcgataagagagggccatagc
tccgtggtcagcttcctagctcctgaatctgatctccaccacagggacgcttccggtctc
actcccctggagttggctcggcagagaggggctcagaacctcatggacattctgcagggg
cacatgatgatcccaatgtga

DBGET integrated database retrieval system