KEGG   Mus musculus (mouse): 12581Help
Entry
12581             CDS       T01002                                 

Gene name
Cdkn2d, INK4d, p19, p19INK4d
Definition
(RefSeq) cyclin dependent kinase inhibitor 2D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    12581 (Cdkn2d)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12581 (Cdkn2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 12581
NCBI-ProteinID: NP_034008
MGI: 105387
Ensembl: ENSMUSG00000096472
Vega: OTTMUSG00000063300
UniProt: Q60773 Q3US51
Structure
PDB: 

Position
9; 9 A3
AA seq 166 aa AA seqDB search
MLLEEVCVGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSPAVALEL
LKQGASPNVQDASGTSPVHDAARTGFLDTLKVLVEHGADVNALDSTGSLPIHLAIREGHS
SVVSFLAPESDLHHRDASGLTPLELARQRGAQNLMDILQGHMMIPM
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggaagaagtctgcgtcggcgaccggttgagtggcgcagcggcccgtggcgac
gtgcaagaggtccgccgccttcttcaccgggagctggtgcatcctgacgccctgaaccgc
tttggcaagacggccttgcaggtcatgatgtttggaagtccagcagttgctttggagctc
ctgaagcaaggtgccagccccaatgtccaagatgcctccggtactagtcctgtgcatgat
gcggctcgcaccgggttcctggacaccctgaaggttctggtggagcatggtgctgatgtc
aatgccctggacagcactgggtcgctccccatccatctggcgataagagagggccatagc
tccgtggtcagcttcctagctcctgaatctgatctccaccacagggacgcttccggtctc
actcccctggagttggctcggcagagaggggctcagaacctcatggacattctgcagggg
cacatgatgatcccaatgtga

DBGET integrated database retrieval system