KEGG   Mus musculus (house mouse): 12589
Entry
12589             CDS       T01002                                 
Symbol
Ift81, AW060663, Cdv-1, Cdv-1r, Cdv1
Name
(RefSeq) intraflagellar transport 81
  KO
K19677  intraflagellar transport protein 81
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    12589 (Ift81)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Intraflagellar transport (IFT) complex B1
   12589 (Ift81)
SSDB
Motif
Pfam: IFT81_CH
Other DBs
NCBI-GeneID: 12589
NCBI-ProteinID: NP_034009
MGI: 1098597
Ensembl: ENSMUSG00000029469
UniProt: O35594
Position
5:complement(122678328..122752614)
AA seq 676 aa
MSDQIKFIVDSLNKEPFKKNYNLITFDSLGPMQLLQVLNDVLAEIDPKQDVDIREEMPEQ
TAKRMLNLLGILKYKPPGNATDMSTFRQGLVIGSKPVIYPVLHWLLQRSNELKKRAYLAR
FLIKLEVPSEFLQDETVADTNKQYEELMEAFKTLHKECEQLKTSGFSTAEIRRDISAMEE
EKDQLMKRVERLKKRVETVQNHQRMLKIARQLRVEKEREEFLAQQKQEQKNQLFHAVQRL
QRVQNQLKSMRHAAADAKPESLMKRLEEEIKFNSYMVTEKFPKELESKKKELHFLQKVVS
EPAMGHSDLLELETKVNEVNTEINQLIEKKMMRNEPIEGKLSLYRQQASIISRKKEAKAE
ELQETKEKLASLEREVLVKTNQTREFDGTEVLKGDEFKRYVSKLRSKSTVFKKKHQIIAE
FKAEFGLLQRTEELLKQRQETIQHQLRTIEEKKGISGYSYTQEELERVSALKSEVDEMKG
RTLDDMSEMVKKLNSLVSEKKSALAPVIKELRQLRQKCQELTQECDEKKAQYDSCAAGLE
SNRSKLEQEVRGLREECLQEESKYHYTNCMIKNLEVELRRATDEMKAYVSSDQQEKRKAI
REQYTKNITEQENLGKKLREKQKAVRESHGPNMKQAKMWRDLEQLMECKKQCFLKQQSPA
SIGQVIQEGGEDRLVL
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgagtgaccaaatcaaattcatcgtggacagcctcaataaggagccttttaagaagaat
tataacttaatcacatttgattctttgggaccaatgcaactattgcaagttctcaatgat
gtcctggctgagattgaccccaagcaagatgttgatatcagagaggagatgccagagcag
acagccaaacgaatgttgaatcttcttggtatccttaagtacaaacctccgggaaatgcc
acagacatgagcaccttccgtcagggcttggtgattggaagtaaacctgtgatttaccca
gtgctccactggcttcttcagcggagtaatgaactaaagaaaagggcatatttagctcgt
ttcttaataaaactggaggtgccaagtgagtttcttcaagatgagaccgtggctgacacc
aataaacagtatgaagagctgatggaagcctttaaaactctgcataaagagtgtgagcag
ctcaaaacatctggattctctacagcagaaatcagaagggatatcagcgcaatggaggag
gaaaaagaccagctcatgaagagagttgaacggctgaagaagagggtggagaccgttcag
aaccatcagcgaatgcttaaaatagcaagacagcttcgagttgagaaagagagagaagaa
tttcttgcacaacagaaacaggaacaaaagaatcagctgtttcatgcggtgcagagattg
cagagagtgcaaaatcagctgaagagcatgcggcacgcagcagcggatgcaaagcctgag
agtttaatgaagaggctagaggaggagataaaatttaactcatacatggtcactgaaaaa
tttccaaaagaattagaaagcaagaaaaaggaattacattttttacagaaggtggtttct
gagccagctatgggccactctgaccttctcgaacttgagactaaagtcaatgaagtaaac
acggagatcaatcagttgattgaaaagaaaatgatgagaaacgagccaattgaaggcaag
ctctcactgtacaggcaacaggcatccatcatttctcgtaagaaagaagccaaagctgag
gagctgcaggagaccaaggagaagctggccagccttgagagagaggtgttggtgaaaaca
aaccagacccgggagttcgacggcactgaggttctgaagggagatgagttcaagcgatac
gtcagtaaacttcgaagcaaaagcacagttttcaaaaagaagcatcagataatagctgaa
tttaaggctgagtttggcctcctgcagaggacagaagaacttctgaagcagcgtcaggaa
accattcagcatcaactgcgaactattgaagaaaagaagggtatatctggatacagttac
acccaagaggagcttgagagagtgtcggccctgaagagtgaggttgacgagatgaaaggc
cggaccctggatgacatgtcagagatggtgaaaaaactgaattccttggtatcagaaaag
aagtcagctttagccccagttataaaagaactacggcagttgcgtcagaaatgtcaagaa
ctaacccaggagtgtgatgagaagaaagcccagtatgatagctgtgcagcaggccttgaa
agcaaccggtccaaattagagcaggaagtgcgaggacttcgtgaggaatgtcttcaagaa
gaaagtaaataccactatacaaactgcatgattaagaacctagaagttgagcttcgtcga
gcgactgatgagatgaaggcgtacgtctcttctgatcagcaagagaagaggaaagcaatt
agggaacagtataccaaaaatattactgagcaagaaaaccttggtaagaaactccgggaa
aaacaaaaagctgtacgagaaagtcatggtccaaacatgaagcaagcaaaaatgtggcgt
gatcttgaacaactgatggaatgcaaaaaacagtgctttctaaagcagcaaagcccagct
tccatcggccaggtaattcaagagggcggagaggaccggctggttctctga

DBGET integrated database retrieval system