KEGG   Mus musculus (mouse): 12590
Entry
12590             CDS       T01002                                 

Symbol
Cdx1, Cdx, Cdx-1
Name
(RefSeq) caudal type homeobox 1
  KO
K09312  homeobox protein CDX1/4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12590 (Cdx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    12590 (Cdx1)
SSDB
Motif
Pfam: Caudal_act Homeodomain Homeobox_KN SUIM_assoc YdaS_antitoxin
Other DBs
NCBI-GeneID: 12590
NCBI-ProteinID: NP_034010
MGI: 88360
Ensembl: ENSMUSG00000024619
Vega: OTTMUSG00000037224
UniProt: P18111
Position
18:complement(61151934..61169271)
AA seq 268 aa
MYVGYVLDKDSPVYPGPARPSSLGLGPPTYAPPGPAPAPPQYPDFAGYTHVEPAPAPPPT
WAAPFPAPKDDWAAAYGPGPTASAASPAPLAFGPPPDFSPVPAPPGPGPGILAQSLGAPG
APSSPGAPRRTPYEWMRRSVAAAGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYIT
IRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPLPPTQLPLPLDGTPTPSG
PPLGSLCPTNAGLLGTPSPVPVKEEFLP
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtacgtgggctatgtgctggacaaggactcccccgtgtacccaggccccgccagaccc
tccagcctcggcctgggccctccgacctatgcgccccctggcccggcgcccgcgcccccg
cagtaccccgacttcgcgggttacacgcacgtggagccggcgcccgcgccccctccgacc
tgggctgcgcccttccctgcgcccaaggacgactgggcagctgcctatggcccgggcccc
acggcctcagccgccagcccggccccgctggccttcgggccccctccggactttagcccg
gtgcccgcgcctcccgggcctggtcccggcatcctggcgcagtccctcggggctccgggc
gcaccgtcctcgccaggagcgccaaggcggacgccctacgaatggatgcggcgcagcgtg
gcggctgcaggcggcggtggcagcggtaagacccgaaccaaggacaagtaccgtgtggtc
tacacagaccaccaacgcctagagctggaaaaggagtttcactacagccggtacatcact
atccggcgcaagtccgagctggctgctaacctggggctcacagagcggcaggtaaagatc
tggttccagaaccgccgggccaaggagcgcaaagtaaacaagaagaaacagcagcagcag
cagcccctgcctcccacacagctgcccctgcccctggatggcactcccacaccatcaggg
ccacccctaggaagtctatgccctactaatgctggccttctgggcaccccctccccagtg
cccgtcaaggaggagtttctaccctag

DBGET integrated database retrieval system