KEGG   Mus musculus (mouse): 12628
Entry
12628             CDS       T01002                                 

Gene name
Cfh, Mud-1, NOM, Sas-1, Sas1
Definition
(RefSeq) complement component factor h
  KO
K04004  complement factor H
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12628 (Cfh)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    12628 (Cfh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12628 (Cfh)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12628 (Cfh)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 12628
NCBI-ProteinID: NP_034018
MGI: 88385
Ensembl: ENSMUSG00000026365
Vega: OTTMUSG00000024648
UniProt: P06909 E9Q8I0
Structure
PDB: 
2YBY

Position
1 61.62 cM; 1 F
AA seq 1252 aa
MVQHRFLLESVGPRKIQIMRLSARIIWLILWTVCAAEDCKGPPPRENSEILSGSWSEQLY
PEGTQATYKCRPGYRTLGTIVKVCKNGKWVASNPSRICRKKPCGHPGDTPFGSFRLAVGS
QFEFGAKVVYTCDDGYQLLGEIDYRECGADGWINDIPLCEVVKCLPVTELENGRIVSGAA
ETDQEYYFGQVVRFECNSGFKIEGHKEIHCSENGLWSNEKPRCVEILCTPPRVENGDGIN
VKPVYKENERYHYKCKHGYVPKERGDAVCTGSGWSSQPFCEEKRCSPPYILNGIYTPHRI
IHRSDDEIRYECNYGFYPVTGSTVSKCTPTGWIPVPRCTLKPCEFPQFKYGRLYYEESLR
PNFPVSIGNKYSYKCDNGFSPPSGYSWDYLRCTAQGWEPEVPCVRKCVFHYVENGDSAYW
EKVYVQGQSLKVQCYNGYSLQNGQDTMTCTENGWSPPPKCIRIKTCSASDIHIDNGFLSE
SSSIYALNRETSYRCKQGYVTNTGEISGSITCLQNGWSPQPSCIKSCDMPVFENSITKNT
RTWFKLNDKLDYECLVGFENEYKHTKGSITCTYYGWSDTPSCYERECSVPTLDRKLVVSP
RKEKYRVGDLLEFSCHSGHRVGPDSVQCYHFGWSPGFPTCKGQVASCAPPLEILNGEING
AKKVEYSHGEVVKYDCKPRFLLKGPNKIQCVDGNWTTLPVCIEEERTCGDIPELEHGSAK
CSVPPYHHGDSVEFICEENFTMIGHGSVSCISGKWTQLPKCVATDQLEKCRVLKSTGIEA
IKPKLTEFTHNSTMDYKCRDKQEYERSICINGKWDPEPNCTSKTSCPPPPQIPNTQVIET
TVKYLDGEKLSVLCQDNYLTQDSEEMVCKDGRWQSLPRCIEKIPCSQPPTIEHGSINLPR
SSEERRDSIESSSHEHGTTFSYVCDDGFRIPEENRITCYMGKWSTPPRCVGLPCGPPPSI
PLGTVSLELESYQHGEEVTYHCSTGFGIDGPAFIICEGGKWSDPPKCIKTDCDVLPTVKN
AIIRGKSKKSYRTGEQVTFRCQSPYQMNGSDTVTCVNSRWIGQPVCKDNSCVDPPHVPNA
TIVTRTKNKYLHGDRVRYECNKPLELFGQVEVMCENGIWTEKPKCRDSTGKCGPPPPIDN
GDITSLSLPVYEPLSSVEYQCQKYYLLKGKKTITCRNGKWSEPPTCLHACVIPENIMESH
NIILKWRHTEKIYSHSGEDIEFGCKYGYYKARDSPPFRTKCINGTINYPTCV
NT seq 3759 nt   +upstreamnt  +downstreamnt
atggtacagcacagatttctcttggagtcagttggtcccagaaagatccaaattatgaga
ctgtcagcaagaattatttggcttatattatggactgtttgtgcagcagaagattgtaaa
ggtcctcctccaagagaaaattcagaaattctctcaggctcgtggtcagaacaactatat
ccagaaggcacccaggctacctacaaatgccgccctggataccgaacacttggcactatt
gtaaaagtatgcaagaatggaaaatgggtggcgtctaacccatccaggatatgtcggaaa
aagccttgtgggcatcccggagacacaccctttgggtcctttaggctggcagttggatct
caatttgagtttggtgcaaaggttgtttatacctgtgatgatgggtatcaactattaggt
gaaattgattaccgtgaatgtggtgcagatgggtggatcaatgatattccactatgtgaa
gttgtgaagtgtctacctgtgacagaactcgagaatggaagaattgtgagtggtgcagca
gaaacagaccaggaatactattttggacaggtggtgcggtttgaatgcaattcaggcttc
aagattgaaggacataaggaaattcattgctcagaaaatggcctttggagcaatgaaaag
ccacgatgtgtggaaattctctgcacaccaccgcgagtggaaaatggagatggtataaat
gtgaaaccagtttacaaggagaatgaaagataccactataagtgtaagcatggttatgtg
cccaaagaaagaggggatgccgtctgcacaggctctggatggagttctcagcctttctgt
gaagaaaagagatgctcacctccttatattctaaatggtatctacacacctcacaggatt
atacacagaagtgatgatgaaatcagatatgaatgtaattatggcttctatcctgtaact
ggatcaactgtttcaaagtgtacacccactggctggatccctgttccaagatgtaccttg
aaaccatgtgaatttccacaattcaaatatggacgtctgtattatgaagagagcctgaga
cccaacttcccagtatctataggaaataagtacagctataagtgtgacaacgggttttca
ccaccttctgggtattcctgggactaccttcgttgcacagcacaagggtgggagcctgaa
gtcccatgcgtcaggaaatgtgttttccattatgtggagaatggagactctgcatactgg
gaaaaagtatatgtgcagggtcagtctttaaaagtccagtgttacaatggctatagtctt
caaaatggtcaagacacaatgacatgtacagagaatggctggtcccctcctcccaaatgc
atccgtatcaagacatgttcagcatcagatatacacattgacaatggatttctttctgaa
tcttcttctatatatgctctaaatagagaaacatcctatagatgtaagcagggatatgtg
acaaatactggagaaatatcaggatcaataacttgccttcaaaatggatggtcacctcaa
ccctcatgcattaagtcttgtgatatgcctgtatttgagaattctataactaagaatact
aggacatggtttaagctcaatgacaaattagactatgaatgtctcgttggatttgaaaat
gaatataaacataccaaaggctctataacatgtacttattatggatggtctgatacaccc
tcatgttatgaaagagaatgcagtgttcccactctagaccgaaaactagtcgtttccccc
agaaaagaaaaatacagagttggagatttgttggaattctcctgccattcaggacacaga
gttgggccagattcagtgcaatgctaccactttggatggtctcctggtttccctacatgt
aaaggtcaagtagcatcatgtgcaccacctcttgaaattcttaatggggaaattaatgga
gcaaaaaaagttgaatacagccatggtgaagtggtgaaatatgattgcaaacctagattc
ctactgaagggacccaataaaatccagtgtgttgatgggaattggacaaccttgcctgta
tgtattgaggaggagagaacatgtggagacattcctgaacttgaacatggctctgccaag
tgttctgttcctccctaccaccatggagattcagtggagttcatttgtgaagaaaacttc
acaatgattggacatgggtcagtttcttgcattagtggaaaatggacccagcttcctaaa
tgtgttgcaacagaccaactggagaagtgtagagtgctgaagtcaactggcatagaagca
ataaaaccaaaattgactgaatttacgcataactccaccatggattacaaatgtagagac
aagcaggagtacgaacgctcaatctgtatcaatggaaaatgggatcctgaaccaaactgt
acaagcaaaacatcctgccctcctccaccgcagattccaaatacccaagtgattgaaacc
accgtgaaatacttggatggagaaaaattatctgttctttgccaagacaattacctaact
caggactcagaagaaatggtgtgcaaagatggaaggtggcagtcattacctcgctgcatt
gaaaaaattccatgttcccagccccctacaatagaacatggatctattaatttacccaga
tcttcagaagaaaggagagattccattgagtccagcagtcatgaacatggaactacattc
agctatgtctgtgatgatggtttcaggatacctgaagaaaataggataacctgctacatg
ggaaaatggagcactccacctcgctgtgttggacttccttgtggacctccaccttcaatt
cctcttggtactgtttctcttgagctagagagttaccaacatggggaagaggttacatac
cattgttctacaggctttggaattgatggaccagcatttattatatgcgaaggaggaaag
tggtctgacccaccaaaatgcataaaaacggattgtgacgttttacccacagttaaaaat
gccataataagaggaaagagcaaaaaatcatataggacaggagaacaagtgacattcaga
tgtcaatctccttatcaaatgaatggctcagacactgtgacatgtgttaatagtcggtgg
attggacagccagtatgcaaagataattcctgtgtggatccaccacatgtgccaaatgct
actatagtaacaaggaccaagaataaatatctacatggtgacagagtacgttatgaatgt
aataaacctttggaactatttgggcaagtggaagtgatgtgtgaaaatgggatatggaca
gaaaaaccaaagtgccgagactcaacagggaaatgtgggcctcctccacctattgacaat
ggagacatcacctccttgtcattaccagtatatgaaccattatcatcagttgaatatcaa
tgccagaagtattatctccttaagggaaagaagacaataacatgtagaaatggaaagtgg
tctgagccaccaacatgcttacatgcatgtgtaataccagaaaacattatggaatcacac
aatataattctcaaatggagacacactgaaaagatttattcccattcaggggaggatatt
gaatttggatgtaaatatggatattataaagcaagagattcaccgccatttcgtacaaag
tgcattaatggcaccatcaattatcccacttgtgtataa

DBGET integrated database retrieval system