KEGG   Mus musculus (mouse): 12630
Entry
12630             CDS       T01002                                 

Gene name
Cfi
Definition
(RefSeq) complement component factor i
  KO
K01333  complement factor I [EC:3.4.21.45]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12630 (Cfi)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    12630 (Cfi)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12630 (Cfi)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12630 (Cfi)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.45  complement factor I
     12630 (Cfi)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   12630 (Cfi)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12630 (Cfi)
SSDB
Motif
Pfam: Trypsin Ldl_recept_a SRCR Trypsin_2 Kazal_2
Other DBs
NCBI-GeneID: 12630
NCBI-ProteinID: NP_031712
MGI: 105937
Ensembl: ENSMUSG00000058952
Vega: OTTMUSG00000054726
UniProt: Q61129
Position
3 G3; 3 59.21 cM
AA seq 603 aa
MKLAHLSLFLLALHLSSSRSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEG
TCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLI
YGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLH
INDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHI
PQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEE
DRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKR
VIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDW
LKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYL
FQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDA
CKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQ
HNV
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgaagctcgctcatctcagtctctttctcttggctctccacttgagttcttccaggtcc
ccgtcagcatcagatctgcctcaggaggagctggtcgatcagaaatgcttactgcagaaa
tacacgcatcgctcctgtaacaaggtcttctgccagccgtggcagagatgtatcgaaggc
acctgtatctgcaaactcccctaccagtgcccaagggctggcaccccagtgtgtgccatg
aatggaaggagctacccgacatactgtcaccagaagagtttcgaatgtcttcacccagag
atcaagttttcacataatggaacgtgcgcagctgaaggaaagtttaatgtttccttaatt
tatgggagaacaaaaacagagggacttgttcaagtcaaacttgtggaccaagatgagaga
atgttcatatgtaaaaacagctggagcatggcggaggccaacgtggcctgcgtcgacctt
ggatttccactgggtgttcgtgacatacaaggaagttttaatatatctggaaatctccat
ataaacgacactgaatgcctgcatgtacattgccggggagtagagaccagtttggcggag
tgtgcctttacgaagaggagaactgagttgtccaatggcttggcgggggtagtgtgttac
aagcaggatgcagatttcccaacgagtctgtccttccagtgtgtgaatgggaagcacatt
cctcaggagaaagcctgcaacggtgtcaatgactgtggagaccaaagcgatgagctgtgt
tgcaaaggttgccgaggtaacgcttccctttgtaagtcgggagtttgcattccagaccaa
tacaagtgtaatggtgaggtggactgcatcactggtgaagatgagagccgttgtgaagaa
gaccgacagcagaacattccaaaaggccttgcacggtcagctcaaggagaagctgaaatt
gaaactgaagaaacagaaatgttgactcctggtatggacaatgaaagaaaacggataaag
tccttattacctaaactctcctgtggagtcaaaagaaacactcacactcgcaggaaacga
gtgatcggagggaagccagcgaatgtgggagactacccatggcaggtggcaattaaggat
ggccaaagaatcacctgtggtggcatttatatcggtggctgttggattctgactgctgcg
cactgtgtcagacccagtagagctcacagttaccaagtctggacggctttattagactgg
ctaaaacctaactctcagttgggaattcaaacggtgaagagagttattgttcacgagaaa
tataatggagccaccttccaaaatgacatagctttgattgaaatgaaaatgcacacgggc
aagaaagaatgtgaactccccaattccgtccctgcctgcgtcccgtggtctccatatctg
ttccaaccgaatgacagatgtatcatctctggatggggtcgagggaaagataaccaaaaa
gtctactcactcaggtggggcgaagttgatctaataggcaactgctctcagttttaccca
gatcgctactatgagaaagagatgcagtgcgcaggtacgcgtgatgggtccattgatgcc
tgcaaaggagactccggaggccccttggtctgtgaggatatcaacaatgtcacttacgtt
tggggcattgtgagctggggagaaaattgtgggaagcccgagttcccaggtgtttacacc
agagtggccaattattttgattggattagctatcacgtaggaaggtctcttgtttctcaa
cacaatgtctga

DBGET integrated database retrieval system