KEGG   Mus musculus (mouse): 12633Help
Entry
12633             CDS       T01002                                 

Gene name
Cflar, 2310024N18Rik, A430105C05Rik, CLARP, Cash, Casper, FLAME, FLAME-1, Flip, Gm9845, I-FLICE, MRIT, c-Flip
Definition
(RefSeq) CASP8 and FADD-like apoptosis regulator
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04140  Autophagy - animal
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04668  TNF signaling pathway
mmu05142  Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    12633 (Cflar)
   04668 TNF signaling pathway
    12633 (Cflar)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    12633 (Cflar)
  09143 Cell growth and death
   04210 Apoptosis
    12633 (Cflar)
   04217 Necroptosis
    12633 (Cflar)
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    12633 (Cflar)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    12633 (Cflar)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12633 (Cflar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DED Peptidase_C14 HTH_20 DUF2367
Motif
Other DBs
NCBI-GeneID: 12633
NCBI-ProteinID: NP_001276633
MGI: 1336166
Ensembl: ENSMUSG00000026031
Vega: OTTMUSG00000019581
UniProt: O35732 Q812G4
Position
1 C1.3; 1 29.16 cM
AA seq 481 aa AA seqDB search
MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDLLDSLSERGQLSFATL
AELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLMEIGESLDQNDVSSLVFL
TRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKNIHRIDLNTKIQKYTQSS
QGARSNMNTLQASLPKLSIKYNSRLQNGRSKEPRFVEYRDSQRTLVKTSIQESGAFLPPH
IREETYRMQSKPLGICLIIDCIGNDTKYLQETFTSLGYHIQLFLFPKSHDITQIVRRYAS
MAQHQDYDSFACVLVSLGGSQSMMGRDQVHSGFSLDHVKNMFTGDTCPSLRGKPKLFFIQ
NYESLGSQLEDSSLEVDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADVSHLEKPSSS
SSVYLQKLSQQLKQGRRRPLVDLHVELMDKVYAWNSGVSSKEKYSLSLQHTLRKKLILAP
T
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcccagagccctgtgtctgccgaggtcattcaccaggtggaagagtgtcttgatgaa
gacgagaaggagatgatgctcttcctgtgtagagatgtgactgagaacctggctgcacct
aacgtcagggacctcctggatagcttaagtgagagaggccagctctcttttgctaccttg
gctgaattgctctacagagtgaggcggtttgaccttctcaagaggatcttgaagacagac
aaagcaaccgtggaggaccacctgcgcagaaaccctcacctggtttctgattatagggtc
ctgctgatggagattggtgagagcttagatcagaacgatgtatcctccttagttttcctt
acaagggattacacaggcagaggcaagatagccaaggacaagagtttcttggatctggtg
attgaattggagaaactgaatctaattgcttcagaccaattgaatttgttagaaaaatgc
ctgaagaacatccacagaatagacttgaacacaaagatccagaagtacacccagtccagc
caaggagcaagatcaaatatgaatactctccaggcttcgctcccaaaattgagtatcaag
tataactcaaggctccagaatgggcgaagtaaagagccaagatttgtggaataccgtgac
agtcaaagaacactggtgaagacatccatccaggaatcaggagcttttttacctccgcac
atccgtgaagagacttacaggatgcagagcaagcccctaggaatctgcttgatcattgat
tgtattggcaacgacacaaaatatcttcaagagaccttcacttccctgggctatcatatc
cagcttttcttgtttcccaagtcacatgacataacccagattgttcgccgatatgcaagt
atggcccaacatcaagactatgacagctttgcatgtgttctggtgagcctaggaggctcc
caaagcatgatgggcagagatcaagttcactcagggttctccttggatcatgtcaagaac
atgttcacgggggacacgtgcccttctctcagagggaagccaaagctcttttttattcag
aactatgagtcgttaggtagccagttggaagatagcagcctggaggtagatgggccatca
ataaaaaatgtggactctaagcccctgcaacccagacactgcacaactcacccagaagct
gatatcttttggagcctgtgcacagcagacgtatctcacttggagaagccctccagctca
tcctctgtgtatctgcagaagctctcccagcagctgaagcaaggcaggagacgcccactc
gtggacctccacgttgaactcatggacaaagtgtatgcgtggaacagtggtgtttcgtct
aaggagaaatacagcctcagcctgcagcacactctgaggaagaaactcatcctggctcct
acgtga

DBGET integrated database retrieval system