KEGG   Mus musculus (mouse): 12633Help
Entry
12633             CDS       T01002                                 

Gene name
Cflar, 2310024N18Rik, A430105C05Rik, CLARP, Cash, Casper, FLAME, FLAME-1, Flip, Gm9845, I-FLICE, MRIT, c-Flip
Definition
(RefSeq) CASP8 and FADD-like apoptosis regulator
  KO
K04724  CASP8 and FADD-like apoptosis regulator
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04140  Autophagy - animal
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04668  TNF signaling pathway
mmu05142  Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    12633 (Cflar)
   04668 TNF signaling pathway
    12633 (Cflar)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    12633 (Cflar)
  09143 Cell growth and death
   04210 Apoptosis
    12633 (Cflar)
   04217 Necroptosis
    12633 (Cflar)
 09160 Human Diseases
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    12633 (Cflar)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    12633 (Cflar)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12633 (Cflar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DED Peptidase_C14 HTH_20 DUF2367
Motif
Other DBs
NCBI-GeneID: 12633
NCBI-ProteinID: NP_001276633
MGI: 1336166
Ensembl: ENSMUSG00000026031
Vega: OTTMUSG00000019581
UniProt: O35732 Q812G4
Position
1 C1.3; 1 29.16 cM
AA seq 481 aa AA seqDB search
MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDLLDSLSERGQLSFATL
AELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLMEIGESLDQNDVSSLVFL
TRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKNIHRIDLNTKIQKYTQSS
QGARSNMNTLQASLPKLSIKYNSRLQNGRSKEPRFVEYRDSQRTLVKTSIQESGAFLPPH
IREETYRMQSKPLGICLIIDCIGNDTKYLQETFTSLGYHIQLFLFPKSHDITQIVRRYAS
MAQHQDYDSFACVLVSLGGSQSMMGRDQVHSGFSLDHVKNMFTGDTCPSLRGKPKLFFIQ
NYESLGSQLEDSSLEVDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADVSHLEKPSSS
SSVYLQKLSQQLKQGRRRPLVDLHVELMDKVYAWNSGVSSKEKYSLSLQHTLRKKLILAP
T
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcccagagccctgtgtctgccgaggtcattcaccaggtggaagagtgtcttgatgaa
gacgagaaggagatgatgctcttcctgtgtagagatgtgactgagaacctggctgcacct
aacgtcagggacctcctggatagcttaagtgagagaggccagctctcttttgctaccttg
gctgaattgctctacagagtgaggcggtttgaccttctcaagaggatcttgaagacagac
aaagcaaccgtggaggaccacctgcgcagaaaccctcacctggtttctgattatagggtc
ctgctgatggagattggtgagagcttagatcagaacgatgtatcctccttagttttcctt
acaagggattacacaggcagaggcaagatagccaaggacaagagtttcttggatctggtg
attgaattggagaaactgaatctaattgcttcagaccaattgaatttgttagaaaaatgc
ctgaagaacatccacagaatagacttgaacacaaagatccagaagtacacccagtccagc
caaggagcaagatcaaatatgaatactctccaggcttcgctcccaaaattgagtatcaag
tataactcaaggctccagaatgggcgaagtaaagagccaagatttgtggaataccgtgac
agtcaaagaacactggtgaagacatccatccaggaatcaggagcttttttacctccgcac
atccgtgaagagacttacaggatgcagagcaagcccctaggaatctgcttgatcattgat
tgtattggcaacgacacaaaatatcttcaagagaccttcacttccctgggctatcatatc
cagcttttcttgtttcccaagtcacatgacataacccagattgttcgccgatatgcaagt
atggcccaacatcaagactatgacagctttgcatgtgttctggtgagcctaggaggctcc
caaagcatgatgggcagagatcaagttcactcagggttctccttggatcatgtcaagaac
atgttcacgggggacacgtgcccttctctcagagggaagccaaagctcttttttattcag
aactatgagtcgttaggtagccagttggaagatagcagcctggaggtagatgggccatca
ataaaaaatgtggactctaagcccctgcaacccagacactgcacaactcacccagaagct
gatatcttttggagcctgtgcacagcagacgtatctcacttggagaagccctccagctca
tcctctgtgtatctgcagaagctctcccagcagctgaagcaaggcaggagacgcccactc
gtggacctccacgttgaactcatggacaaagtgtatgcgtggaacagtggtgtttcgtct
aaggagaaatacagcctcagcctgcagcacactctgaggaagaaactcatcctggctcct
acgtga

DBGET integrated database retrieval system