KEGG   Mus musculus (mouse): 12640
Entry
12640             CDS       T01002                                 

Gene name
Cga, CG-alpha, FSHA, GPH, GPHA1, GPHalpha, HCG, LHA, Ts, Tsha, aG, aGSU, al, alp, alph, alpha-GSU, alphaGSU, alphaSU
Definition
(RefSeq) glycoprotein hormones, alpha subunit
  KO
K08522  glycoprotein hormones alpha chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04917  Prolactin signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04923  Regulation of lipolysis in adipocytes
mmu04929  GnRH secretion
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    12640 (Cga)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12640 (Cga)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    12640 (Cga)
   04929 GnRH secretion
    12640 (Cga)
   04912 GnRH signaling pathway
    12640 (Cga)
   04913 Ovarian steroidogenesis
    12640 (Cga)
   04917 Prolactin signaling pathway
    12640 (Cga)
   04918 Thyroid hormone synthesis
    12640 (Cga)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    12640 (Cga)
SSDB
Motif
Pfam: Hormone_6
Other DBs
NCBI-GeneID: 12640
NCBI-ProteinID: NP_034019
MGI: 88390
Ensembl: ENSMUSG00000028298
Vega: OTTMUSG00000006474
UniProt: P01216 A0A0F7RQH1
Position
4 A5; 4 16.86 cM
AA seq 120 aa
MDYYRKYAAVILVMLSMFLHILHSLPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
NT seq 363 nt   +upstreamnt  +downstreamnt
atggattactacagaaaatatgcagctgtcattctggtcatgctgtccatgttcctgcat
attcttcattctcttcctgatggagactttattattcagggttgcccagaatgtaaacta
aaggaaaataaatacttctccaagctaggagcccccatctaccagtgtatgggctgttgc
ttctccagggcatatcccactcccgccaggtccaagaagacaatgctggttccaaagaat
attacctcggaggccacatgctgtgtggccaaagcatttactaaggccacagtaatggga
aatgccagagtggagaatcatacggagtgccactgtagcacttgctactaccacaagtcg
tag

KEGG   Mus musculus (mouse): 22094
Entry
22094             CDS       T01002                                 

Gene name
Tshb, thyr
Definition
(RefSeq) thyroid stimulating hormone, beta subunit
  KO
K05251  thyrotropin subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04918  Thyroid hormone synthesis
mmu04923  Regulation of lipolysis in adipocytes
mmu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    22094 (Tshb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22094 (Tshb)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    22094 (Tshb)
   04918 Thyroid hormone synthesis
    22094 (Tshb)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    22094 (Tshb)
SSDB
Motif
Pfam: Cys_knot MafB19-deam
Other DBs
NCBI-GeneID: 22094
NCBI-ProteinID: NP_001159411
MGI: 98848
Ensembl: ENSMUSG00000027857
Vega: OTTMUSG00000054695
UniProt: E9Q4F3
Position
3 F2.2; 3 45.25 cM
AA seq 138 aa
MSAAVLLSVLFALACGQAASFCIPTEYTMYVDRRECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYRDFIYRTVEIPGCPHHVTPYFSFPVAISCKCGKCNTDNSDCIHEAV
RTNYCTKPQSFYLGGFSV
NT seq 417 nt   +upstreamnt  +downstreamnt
atgagtgctgccgtcctcctctccgtgctttttgctcttgcttgtgggcaagcagcatcc
ttttgtattcccactgagtatacaatgtacgtggataggagagagtgtgcctactgcctg
accatcaacaccaccatctgtgctgggtattgtatgacacgggatatcaatggcaaactg
tttcttcccaaatatgcactctctcaggatgtctgtacatacagagacttcatctacaga
acggtggaaataccaggatgcccgcaccatgttactccttatttctccttccctgtcgcc
ataagctgcaagtgtggcaagtgtaatactgacaacagtgactgcatacacgaggctgtc
agaaccaactactgcaccaagccgcagtctttctatctggggggattttctgtttaa

DBGET integrated database retrieval system