KEGG   Mus musculus (mouse): 12643
Entry
12643             CDS       T01002                                 

Gene name
Chad, SLRR4A
Definition
(RefSeq) chondroadherin
  KO
K06248  chondroadherin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12643 (Chad)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12643 (Chad)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12643 (Chad)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12643 (Chad)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12643 (Chad)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class IV
    12643 (Chad)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRRNT LRR_9 LRRCT A-2_8-polyST
Other DBs
NCBI-GeneID: 12643
NCBI-ProteinID: NP_031715
MGI: 1096866
Ensembl: ENSMUSG00000039084
Vega: OTTMUSG00000002018
UniProt: O55226 Q3TYW1
Position
11 D; 11 58.9 cM
AA seq 358 aa
MARALLFSLVFLAILLPALAACPQNCHCHGDLQHVICDKVGLQKIPKVSETTKLLNLQRN
NFPVLAANSFRTMPNLVSLHLQHCNIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDD
LTELTYLYLDHNKVSELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSEN
ALSSLQPGSLDDVENLAKFHLDKNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQS
FGRYLETLWLDNTNLEKFSDAAFSGVTTLKHVHLDNNRLNQLPSSFPFDNLETLTLTNNP
WKCTCQLRGLRRWLEAKASRPDATCSSPAKFKGQRIRDTDALRSCKSPTKRSKKAGRH
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcccgcgcgctcttattcagtctggtctttcttgccatcctcctgcctgcgctagcc
gcctgcccccaaaactgccactgccatggagatctgcagcatgtcatctgcgacaaggtg
gggctgcagaagatccccaaggtatcagagacaaccaaactgctcaatctccagcgcaac
aacttcccggtgctggctgccaactcgtttcggaccatgccgaacctggtctccctgcac
ctgcaacactgcaacatccgcgaggtggcggctggtgccttccgaggcctgaagcagctt
atctacctgtacctgtcccacaacgacatccgggtattgcgagctggagccttcgacgac
ctgactgaactcacttacctctatctagaccacaacaaagtgtcggaactgccccggggg
ttgctctctcctctggtcaacctcttcatcttgcaactcaacaacaacaaaatccgagag
ctgcgtgctggagctttccagggggccaaggacctgcgctggctctacctgtcagaaaat
gccctcagttccctgcagcctggttccctggatgatgtggagaacctagccaagttccac
ctggacaagaaccagctgtctagctacccctcagccgccctgagcaaacttcgggtggtg
gaggagctgaagctgtctcacaaccctctgaagagcatcccagacaatgccttccagtcc
ttcggtagatatctggagaccctctggctggataacaccaacctggagaagttctcagat
gctgccttctcgggtgtgaccacactgaaacacgtccatctggacaacaaccgcctgaac
caactgccttcctccttcccctttgacaacctggagaccctcactctcaccaacaaccca
tggaaatgcacctgccagctccgtggccttcggcggtggttggaagccaaggcttctcga
ccggatgctacctgctcctcgccagccaagttcaagggtcagcggattcgtgacacagat
gcccttcgcagctgcaaatccccgaccaagaggtccaagaaagctggccgccattaa

DBGET integrated database retrieval system