KEGG   Mus musculus (mouse): 12643
Entry
12643             CDS       T01002                                 

Gene name
Chad, S, SLRR4A
Definition
(RefSeq) chondroadherin
  KO
K06248  chondroadherin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12643 (Chad)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12643 (Chad)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12643 (Chad)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12643 (Chad)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12643 (Chad)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class IV
    12643 (Chad)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRRNT LRR_9 LRRCT A-2_8-polyST
Other DBs
NCBI-GeneID: 12643
NCBI-ProteinID: NP_031715
MGI: 1096866
Ensembl: ENSMUSG00000039084
Vega: OTTMUSG00000002018
UniProt: O55226 Q3TYW1
Position
11 D; 11 58.9 cM
AA seq 358 aa
MARALLFSLVFLAILLPALAACPQNCHCHGDLQHVICDKVGLQKIPKVSETTKLLNLQRN
NFPVLAANSFRTMPNLVSLHLQHCNIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDD
LTELTYLYLDHNKVSELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSEN
ALSSLQPGSLDDVENLAKFHLDKNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQS
FGRYLETLWLDNTNLEKFSDAAFSGVTTLKHVHLDNNRLNQLPSSFPFDNLETLTLTNNP
WKCTCQLRGLRRWLEAKASRPDATCSSPAKFKGQRIRDTDALRSCKSPTKRSKKAGRH
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcccgcgcgctcttattcagtctggtctttcttgccatcctcctgcctgcgctagcc
gcctgcccccaaaactgccactgccatggagatctgcagcatgtcatctgcgacaaggtg
gggctgcagaagatccccaaggtatcagagacaaccaaactgctcaatctccagcgcaac
aacttcccggtgctggctgccaactcgtttcggaccatgccgaacctggtctccctgcac
ctgcaacactgcaacatccgcgaggtggcggctggtgccttccgaggcctgaagcagctt
atctacctgtacctgtcccacaacgacatccgggtattgcgagctggagccttcgacgac
ctgactgaactcacttacctctatctagaccacaacaaagtgtcggaactgccccggggg
ttgctctctcctctggtcaacctcttcatcttgcaactcaacaacaacaaaatccgagag
ctgcgtgctggagctttccagggggccaaggacctgcgctggctctacctgtcagaaaat
gccctcagttccctgcagcctggttccctggatgatgtggagaacctagccaagttccac
ctggacaagaaccagctgtctagctacccctcagccgccctgagcaaacttcgggtggtg
gaggagctgaagctgtctcacaaccctctgaagagcatcccagacaatgccttccagtcc
ttcggtagatatctggagaccctctggctggataacaccaacctggagaagttctcagat
gctgccttctcgggtgtgaccacactgaaacacgtccatctggacaacaaccgcctgaac
caactgccttcctccttcccctttgacaacctggagaccctcactctcaccaacaaccca
tggaaatgcacctgccagctccgtggccttcggcggtggttggaagccaaggcttctcga
ccggatgctacctgctcctcgccagccaagttcaagggtcagcggattcgtgacacagat
gcccttcgcagctgcaaatccccgaccaagaggtccaagaaagctggccgccattaa

KEGG   Mus musculus (mouse): 12824
Entry
12824             CDS       T01002                                 

Gene name
Col2a1, Co, Col2, Col2a, Col2a-1, Del, Del1, Dmm, L, Lpk, M100413, Rgsc4, Rgsc413, Rgsc8, Rgsc856
Definition
(RefSeq) collagen, type II, alpha 1
  KO
K19719  collagen type II alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12824 (Col2a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12824 (Col2a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12824 (Col2a1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12824 (Col2a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12824 (Col2a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12824 (Col2a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12824 (Col2a1)
SSDB
Motif
Pfam: Collagen COLFI VWC Amnionless
Other DBs
NCBI-GeneID: 12824
NCBI-ProteinID: NP_112440
MGI: 88452
Ensembl: ENSMUSG00000022483
Vega: OTTMUSG00000021708
UniProt: P28481
Position
15 F1; 15 53.97 cM
AA seq 1487 aa
MIRLGAPQSLVLLTLLIAAVLRCQGQDAQEAGSCLQNGQRYKDKDVWKPSSCRICVCDTG
NVLCDDIICEDPDCLNPEIPFGECCPICPADLATASGKLGPKGQKGEPGDIRDIIGPRGP
PGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPAGPPGPPGPPGLSAGNFA
AQMAGGYDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPAGKPGDDGEAGKPGKSGERGLPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQG
APGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRG
LPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPG
DDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAG
PTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGEQGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGSNGIPGPIGPPGPRGRSGETGPVG
PPGSPGPPGPPGPPGPGIDMSAFAGLGQREKGPDPMQYMRADEADSTLRQHDVEVDATLK
SLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTK
HTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCFL
NT seq 4464 nt   +upstreamnt  +downstreamnt
atgatccgcctcggggctccccagtcgctggtgctgctgacgctgctcatcgccgcggtc
ctacggtgtcagggccaggatgcccaggaggctggcagctgtctgcagaatgggcagagg
tataaagataaggatgtatggaagccctcatcttgccgcatctgtgtgtgtgacactggg
aatgtcctctgcgatgacattatctgtgaagacccagactgcctcaaccccgagatcccc
ttcggagagtgctgtcccatctgcccagctgacctcgccactgccagtggaaaattaggg
ccaaaggggcagaaaggagaacctggagatatcagagatatcataggacccagaggacct
cctggccctcagggacctgcaggtgaacaaggacccagaggtgatcgtggtgacaaggga
gaaaagggtgcgcctggaccccgtggcagagatggagaacctggtacccctggaaatcct
ggccccgctggccctccaggtccccctggtccccctggccttagtgcaggaaacttcgcg
gctcagatggctggagggtatgacgagaaggctggtggtgcccagatgggagtcatgcaa
gggcccatgggccccatgggaccccgtggacccccaggccctgccggtgcccccggccct
caaggatttcaaggcaatcctggtgaacctggcgagcctggtgtctctggtcccatgggt
ccccgaggtcctcctggccctgctggaaaacctggtgacgacggtgaagctgggaagccc
ggaaagtctggggaaagaggcctccctggccctcagggtgctcgtggattcccaggaacc
ccgggtctccccggtgtcaagggtcacagaggttacccaggcctcgacggtgctaagggg
gaagctggtgctccgggtgtgaagggtgagagtggttcccctggtgagaacggatccccg
ggcccaatgggtccccgtggcctgcctggtgagagaggacggactggccctgctggtgct
gctggtgctcggggtaacgatggccagccaggccccgctggacctccgggtcctgtgggt
cccgcaggtggtcctggcttccctggtgctcctggtgccaagggcgaagctggtcccact
ggtgctcgcggtcctgaaggtgctcaaggttctcgtggcgagcctggcaatcctgggtcc
cctgggcctgcaggtgcttctggtaacccagggactgatggtattcctggagccaaagga
tccgctggtgctcctggaattgctggtgcccctggcttccctgggccccgtggccctccc
ggtcctcaaggtgcaactggtccccttggccccaaaggtcaggcgggtgaacctggcatt
gctggctttaaaggtgatcaaggccccaagggagagactggacctgctgggccccaagga
gcccctggccccgctggtgaagaaggcaaacgaggtgctcgaggagagccgggtggtgct
ggaccaatcggaccccctggagagagaggtgctcctggcaaccgtggattcccaggtcaa
gatggtctggcaggtcccaagggtgcccctggagagcgagggcccagtggcttgactggt
cccaagggagccaacggtgacccgggtcgtcctggagaacctggtcttcctggagccagg
ggtcttaccggtcgccctggtgacgctggtcctcaaggcaaagttggtccttctggagcc
cctggtgaagacggtcgccctggacctcctggtcctcagggagctcgtgggcagcctggc
gtcatgggtttccctggccccaaaggtgccaacggcgagcctggcaaagctggtgagaag
ggtctggctggcgctcctggtctgagaggtcttcctggaaaagacggtgagacgggagcc
gcaggaccccccggccccagtggacctgctggtgaacgaggcgagcagggcgctcctgga
ccatcagggttccagggacttcctggccctcccggtcccccaggtgaaggtggaaagcaa
ggtgaccagggtattcctggtgaagctggagctcctggccttgtgggtcctcggggcgag
cgaggtttcccaggtgaacgtggctctcctggtgctcagggccttcagggtccccgaggc
ctccctggcactcctggtactgatggtcccaaaggtgcagctggcccagatggcccccct
ggggctcaggggcctccaggtctacagggaatgcctggtgagagaggagccgctggcatt
gctgggcccaagggagacagaggcgatgttggcgagaaaggcccagagggagctcctggg
aaggatggcggccgaggtctgactgggcccatcggacccccaggcccagcaggggccaac
ggcgagaagggagaagtcggacctcctggcccgtcaggaagtaccggagctcgaggtgcc
ccgggtgaacgcggagagaccgggccacctggacctgctggattcgctggccctcctggt
gctgatggccagcctggtgccaagggtgatcaaggagaagccggacagaaaggagatgct
ggtgcccccggcccacaaggcccctcgggagcccctgggccacagggtcctactggagtg
actggtcctaagggagcccgaggtgcccaaggtcccccgggagccaccggattccctgga
gctgctggccgagttggacccccaggtgctaatggcaatcctggacccgccggtccccct
ggtcctgctggaaaagatggtcccaaaggtgttcgaggagacagtggcccccctggcaga
gctggtgaccccggtcttcaaggtcctgcaggagctcctggcgagaaaggagaacctgga
gatgatggtccctctggtcttgatggtcctccaggtccccaggggctggctggtcaaagg
ggcattgttggtctgcctggtcagcgtggtgagagaggattccccggccttcccggccca
tcgggtgagcccggcaagcagggtgcacctggcgcgtctggagacagaggtcctcctggt
cctgtggggcctcctggcctgacagggcctgcaggtgaacctggacgagagggcagccct
ggtgctgatggaccccctggaagagatggtgcagctggagtcaagggagatcgtggtgag
actggagcactgggtgcccctggagctcctgggcccccaggctctcctggtcctgctggc
ccaactggcaaacaaggagacagaggagaggctggtgcacaaggtcctatgggtccctca
ggacctgctggagcccgtgggattgcaggccctcaaggcccccgaggtgacaaaggagaa
tctggagagcagggcgagaggggactgaagggacaccgaggtttcactggactgcagggt
ctgcctggccctccgggtccttctggagatcagggtgcttctggccctgctggtccttct
ggccctagaggtccacctggccctgttggtccctctggcaaagatggctctaatggaatc
cctggccccatcgggcctccaggtccccgtggacgctcaggagaaacaggccctgttggt
ccccctggaagtcccggtcctcctggccctccaggtcctcctggtcctggcatcgacatg
tcagcctttgctggcttagggcagagagagaagggccccgaccccatgcagtacatgcgg
gccgacgaggcagacagtaccttgagacagcacgacgtggaggtggacgctacactcaag
tcactgaacaaccagattgagagcatccgcagccccgacggctcccgcaagaaccctgct
cgcacttgccaagacctgaaactctgccaccccgagtggaagagcggagactactggatt
gatcccaaccagggctgcaccttggacgccatgaaagttttctgcaacatggagaccggc
gagacttgcgtctaccccaacccagcgactgtccctcggaaaaactggtggagcagcaag
agcaaggaaaagaaacacatctggtttggagagaccatgaacggtggcttccacttcagc
tatggcgatggcaacctggctcccaacaccgctaacgtccagatgactttcctccgtcta
ctgtccactgagggctcccagaacatcacctaccactgtaagaacagcatcgcctacctg
gacgaagcggctggcaacctcaagaaggccttgctcatccagggctccaatgatgtagag
atgagggccgagggcaacagcaggttcacatacactgccctgaaggatggctgcacgaaa
cacactggtaagtggggcaagaccgtcatcgagtaccgatcacagaagacctcccgcctt
cccattattgacatcgcacccatggacattggaggggctgaacaggaatttggtgtggac
atagggcctgtctgcttcttgtaa

KEGG   Mus musculus (mouse): 12826
Entry
12826             CDS       T01002                                 

Gene name
Col4a1, Br, Bru, Col4, Col4a-1, Del(8)44, R, Raw, S, Svc
Definition
(RefSeq) collagen, type IV, alpha 1
  KO
K06237  collagen type IV alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12826 (Col4a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12826 (Col4a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12826 (Col4a1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12826 (Col4a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    12826 (Col4a1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12826 (Col4a1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12826 (Col4a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12826 (Col4a1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12826 (Col4a1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12826 (Col4a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12826 (Col4a1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12826 (Col4a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12826 (Col4a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12826 (Col4a1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 12826
NCBI-ProteinID: NP_034061
MGI: 88454
Ensembl: ENSMUSG00000031502
Vega: OTTMUSG00000021316
UniProt: P02463
Position
8 A1.1; 8 5.53 cM
AA seq 1669 aa
MGPRLSVWLLLLFAALLLHEERSRAAAKGDCGGSGCGKCDCHGVKGQKGERGLPGLQGVI
GFPGMQGPEGPHGPPGQKGDAGEPGLPGTKGTRGPPGAAGYPGNPGLPGIPGQDGPPGPP
GIPGCNGTKGERGPLGPPGLPGFSGNPGPPGLPGMKGDPGEILGHVPGTLLKGERGFPGI
PGMPGSPGLPGLQGPVGPPGFTGPPGPPGPPGPPGEKGQMGSSFQGPKGDKGEQGVSGPP
GVPGQAQVKEKGDFAPTGEKGQKGEPGFPGVPGYGEKGEPGKQGPRGKPGKDGEKGERGS
PGIPGDSGYPGLPGRQGPQGEKGEAGLPGPPGTVIGTMPLGEKGDRGYPGAPGLRGEPGP
KGFPGTPGQPGPPGFPTPGQAGAPGFPGERGEKGDQGFPGVSLPGPSGRDGAPGPPGPPG
PPGQPGHTNGIVECQPGPPGDQGPPGTPGQPGLTGEVGQKGQKGESCLACDTEGLRGPPG
PQGPPGEIGFPGQPGAKGDRGLPGRDGLEGLPGPQGSPGLIGQPGAKGEPGEIFFDMRLK
GDKGDPGFPGQPGMPGRAGTPGRDGHPGLPGPKGSPGSIGLKGERGPPGGVGFPGSRGDI
GPPGPPGVGPIGPVGEKGQAGFPGGPGSPGLPGPKGEAGKVVPLPGPPGAAGLPGSPGFP
GPQGDRGFPGTPGRPGIPGEKGAVGQPGIGFPGLPGPKGVDGLPGEIGRPGSPGRPGFNG
LPGNPGPQGQKGEPGIGLPGLKGQPGLPGIPGTPGEKGSIGGPGVPGEQGLTGPPGLQGI
RGDPGPPGVQGPAGPPGVPGIGPPGAMGPPGGQGPPGSSGPPGIKGEKGFPGFPGLDMPG
PKGDKGSQGLPGLTGQSGLPGLPGQQGTPGVPGFPGSKGEMGVMGTPGQPGSPGPAGTPG
LPGEKGDHGLPGSSGPRGDPGFKGDKGDVGLPGMPGSMEHVDMGSMKGQKGDQGEKGQIG
PTGDKGSRGDPGTPGVPGKDGQAGHPGQPGPKGDPGLSGTPGSPGLPGPKGSVGGMGLPG
SPGEKGVPGIPGSQGVPGSPGEKGAKGEKGQSGLPGIGIPGRPGDKGDQGLAGFPGSPGE
KGEKGSAGTPGMPGSPGPRGSPGNIGHPGSPGLPGEKGDKGLPGLDGVPGVKGEAGLPGT
PGPTGPAGQKGEPGSDGIPGSAGEKGEQGVPGRGFPGFPGSKGDKGSKGEVGFPGLAGSP
GIPGVKGEQGFMGPPGPQGQPGLPGTPGHPVEGPKGDRGPQGQPGLPGHPGPMGPPGFPG
INGPKGDKGNQGWPGAPGVPGPKGDPGFQGMPGIGGSPGITGSKGDMGLPGVPGFQGQKG
LPGLQGVKGDQGDQGVPGPKGLQGPPGPPGPYDVIKGEPGLPGPEGPPGLKGLQGPPGPK
GQQGVTGSVGLPGPPGVPGFDGAPGQKGETGPFGPPGPRGFPGPPGPDGLPGSMGPPGTP
SVDHGFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTM
PFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPISGDNIRPFISRCAVCEAPAMVMAV
HSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRG
TCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT
NT seq 5010 nt   +upstreamnt  +downstreamnt
atggggccccggctcagcgtctggcttctgctgctcttcgccgcccttctgctccacgag
gagcgcagccgagcagctgcgaagggcgattgtggtggctctggctgtggaaaatgtgac
tgtcatggcgtgaagggacaaaagggagaaagaggcttgccagggttgcaaggtgtcatt
ggatttcccgggatgcaaggacctgaggggccacatggaccaccaggacaaaagggtgat
gctggagaacctggacttcctggcacaaaagggacgaggggaccccctggagcagctggc
taccctgggaatcccggacttcctggtattcctggccaagatggccctccaggtccccca
ggtatcccaggatgcaacggtacaaagggagagagagggccgctcggtcctcctggcttg
cctggattcagcggcaatcctggaccaccagggttaccaggaatgaagggagatcctggt
gaaattctcggccacgttcccggaacactgctgaaaggggagagaggatttcctggtatc
cccgggatgccgggctcaccagggttgccaggactccagggacccgtgggtcctccggga
tttactggaccaccgggtcctccaggccctcctggacctcctggagaaaagggccagatg
ggctccagcttccaaggaccaaaaggtgacaagggagagcaaggggtcagcggtcccccg
ggagttcctggacaggcacaagttaaggaaaaaggagactttgccccaacaggagaaaag
ggtcagaaaggtgaacctggatttccgggagtaccaggatatggagagaaaggtgaacct
ggcaagcaagggcctcggggaaaacctgggaaagacggtgaaaaaggagaaagggggagc
ccgggcattcctggcgattccgggtacccaggtctcccaggccggcagggcccgcaggga
gagaagggtgaagctggacttccaggcccccctggaactgtgataggcaccatgcctttg
ggagagaaaggagatcgaggctacccaggagcaccagggttgagaggagagcccggccct
aaaggtttccctggaacaccaggccaaccaggccctccaggtttccctactccaggccag
gctggtgctccaggcttcccaggtgaaaggggagaaaaaggtgaccagggatttccaggc
gtgtcattgccaggaccaagtggaagagatggagccccggggcctcccggccctcccggc
ccccctgggcagccaggccacacaaatggcattgtggagtgtcaacctggaccacccggg
gaccagggccctcctgggactccaggacagccaggtttgacaggtgaagttggacagaaa
ggtcagaaaggagagagctgccttgcctgtgacacagaaggacttcgtggccctccaggg
ccacaggggcctccgggagagattggtttccctggacaacctggggctaaaggtgaccga
ggcctgcccggcagagatggtcttgaaggattgccgggtccacaaggttcaccagggctt
ataggccagcctggagctaagggagagcctggagagatattttttgacatgcgactcaaa
ggtgacaaaggagacccaggttttccgggacagcctggcatgccaggaagagcaggaact
cccggaagagatggccacccaggactccctggacccaaaggctctccgggttcaatagga
ttgaaaggagagcgaggtcctcccggaggagttggcttccctggtagtcgtggagacatc
ggccctcctggacccccaggagttggccccattggtcctgttggtgaaaaaggacaagca
ggctttcctggaggccctgggtccccaggtcttccaggcccaaagggtgaggcaggaaag
gttgtcccactccctggccccccaggagctgcaggacttccaggatcccctggcttccca
gggccacaaggtgaccgaggcttcccaggaaccccaggacgtccaggcatcccgggagag
aaaggtgctgtgggccagccaggaattggatttcctgggcttcctggccccaaaggtgtt
gatggcttgcctggagagataggacggcctgggagtccaggtcgccctggatttaacggc
ttacctggcaacccaggacctcaaggtcaaaagggagaacctggcattgggcttccagga
ctcaaagggcaaccaggccttccaggcattcccggtacacctggagagaagggtagcatc
gggggacccggcgttccaggagaacaggggttgacaggccccccaggactccaggggatc
agaggtgacccagggcctcctggagttcaaggcccagcaggtccaccaggggtcccagga
atagggccacccggagctatgggccctcccggagggcaaggaccaccagggtcatcaggt
ccacctggaattaaaggagagaaagggttccctggattccccggactggatatgcctggc
cccaaaggcgataaaggctctcaaggacttcctggcctcacaggacagtcaggcctccct
ggccttcctggacagcaggggacacctggagttccagggttcccaggttctaaaggtgaa
atgggtgtcatgggaaccccgggacaaccaggctcgccaggaccagcaggcaccccaggg
ttacctggagaaaaaggggaccatggccttccgggctcctcaggacccaggggcgaccct
ggcttcaaaggtgataaaggtgacgttgggcttcctggcatgccaggatccatggagcat
gtggacatggggagcatgaagggacagaaaggagaccagggagagaaaggacaaatcgga
cccactggtgataaaggttcccgaggagaccctggaacaccaggagtacctgggaaggat
gggcaggcagggcatcccggacagccagggcctaaaggtgacccaggccttagtgggaca
ccaggatcccctggactccctggacccaaaggatcagttggaggaatgggcttgccaggt
tcgcctggagaaaaaggtgtgcctggcatccctggctcacagggtgtccctggctcacct
ggagagaagggagccaaaggagagaaagggcagtcaggtctacctggcattgggattccg
ggacggcctggtgacaagggagaccagggccttgctggcttcccaggcagccccggtgag
aagggagagaaaggcagtgccggaaccccagggatgccagggtccccaggcccgagaggt
tctccggggaacatcggccatccaggaagcccaggcctgcctggagagaaaggggataaa
ggcctcccaggactggatggcgttcctggtgtcaaaggagaagcaggtctccctgggact
cctggccccacaggcccagctggccagaagggagagccgggcagcgatggaatcccgggg
tcggcaggagagaagggtgaacaaggtgttccaggaagaggcttccccggcttccctggc
tccaaaggagacaaaggctccaagggtgaagtgggtttccctggcctagctggaagtcct
ggaattcctggagtcaaaggcgagcaagggttcatgggtcctcctggccctcaaggacaa
cctggcttacctggcactcctggtcaccctgtggaggggcccaaaggagaccgaggacct
cagggtcaacctggcctgccagggcatccgggacctatggggccgccagggttcccagga
atcaatgggccaaaaggtgacaagggaaatcaaggttggccaggagctccgggggttcca
ggccctaagggagacccaggattccaaggcatgccgggcattggcggctctccagggatc
acaggttcaaagggagatatgggactgcccggagttccaggatttcaaggtcagaaaggg
cttcctggtctgcagggagtgaaaggagaccagggagaccaaggtgtacccggccctaaa
ggtctccaaggtccccctgggcctccaggtccctacgatgtcatcaaaggagaaccaggg
ctccctggtcctgagggtccccctggtcttaaaggactccagggaccaccaggtccaaaa
ggacagcaaggtgtgacaggctcagtgggcttgcctggacctccaggtgtccctgggttc
gatggtgctcctggccagaaaggagagacaggaccctttggaccacctggtccaagaggg
tttcctggcccaccaggccccgatgggctgccaggatccatgggtcccccaggtacccca
tctgtggaccatggcttccttgtgaccaggcatagtcagacaacagatgacccactgtgt
cccccagggaccaaaattctttaccatggatactctctgctctatgtccaaggcaacgag
cgtgcccacgggcaggacttgggtacggctggcagctgcctgcgtaagttcagcaccatg
ccctttctcttctgcaacatcaacaacgtctgcaacttcgcctccaggaacgactactct
tactggctgtccacgccagagcccatgcccatgtccatggcacccatctctggggacaac
atccggcccttcattagcaggtgtgcggtttgtgaagcaccggccatggtgatggcggta
cacagtcagaccattcagattccgcagtgccctaacggttggtcctcactgtggatcggc
tattccttcgtgatgcacaccagcgctggtgctgaaggttccggccaagccctcgcatcc
cccgggtcctgtctggaagagtttagaagcgccccattcatcgagtgccacggcagagga
acgtgcaattactacgcaaatgcttacagcttttggctcgccaccatagagagaagcgag
atgttcaagaagcccacgccatccaccttgaaggcaggggagctgcgaacacacgtcagc
cgctgccaagtgtgcatgagaagaacataa

KEGG   Mus musculus (mouse): 12827
Entry
12827             CDS       T01002                                 

Gene name
Col4a2, Col4, Col4a-2
Definition
(RefSeq) collagen, type IV, alpha 2
  KO
K06237  collagen type IV alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12827 (Col4a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12827 (Col4a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12827 (Col4a2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12827 (Col4a2)
  09154 Digestive system
   04974 Protein digestion and absorption
    12827 (Col4a2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12827 (Col4a2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12827 (Col4a2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12827 (Col4a2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12827 (Col4a2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12827 (Col4a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12827 (Col4a2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12827 (Col4a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12827 (Col4a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12827 (Col4a2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 12827
NCBI-ProteinID: NP_034062
MGI: 88455
Ensembl: ENSMUSG00000031503
Vega: OTTMUSG00000021317
UniProt: P08122 B2RQQ8
Position
8 A1.1; 8 5.62 cM
AA seq 1707 aa
MDRVRFKASGPPLRGWLLLATVTVGLLAQSVLGGVKKLDVPCGGRDCSGGCQCYPEKGAR
GQPGAVGPQGYNGPPGLQGFPGLQGRKGDKGERGVPGPTGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGRPGYDGCNGTRGDAGPQGPSGSGGFPGLPGPQGPKGQKGEPYALSKEDRD
KYRGEPGEPGLVGYQGPPGRPGPIGQMGPMGAPGRPGPPGPPGPKGQPGNRGLGFYGQKG
EKGDIGQPGPNGIPSDITLVGPTTSTIHPDLYKGEKGDEGEQGIPGVISKGEEGIMGFPG
IRGFPGLDGEKGVVGQKGSRGLDGFQGPSGPRGPKGERGEQGPPGPSVYSPHPSLAKGAR
GDPGFQGAHGEPGSRGEPGEPGTAGPPGPSVGDEDSMRGLPGEMGPKGFSGEPGSPARYL
GPPGADGRPGPQGVPGPAGPPGPDGFLFGLKGSEGRVGYPGPSGFPGTRGQKGWKGEAGD
CQCGQVIGGLPGLPGPKGFPGVNGELGKKGDQGDPGLHGIPGFPGFKGAPGVAGAPGPKG
IKGDSRTITTKGERGQPGIPGVHGMKGDDGVPGRDGLDGFPGLPGPPGDGIKGPPGDAGL
PGVPGTKGFPGDIGPPGQGLPGPKGERGFPGDAGLPGPPGFPGPPGPPGTPGQRDCDTGV
KRPIGGGQQVVVQPGCIEGPTGSPGQPGPPGPTGAKGVRGMPGFPGASGEQGLKGFPGDP
GREGFPGPPGFMGPRGSKGTTGLPGPDGPPGPIGLPGPAGPPGDRGIPGEVLGAQPGTRG
DAGLPGQPGLKGLPGETGAPGFRGSQGMPGMPGLKGQPGFPGPSGQPGQSGPPGQHGFPG
TPGREGPLGQPGSPGLGGLPGDRGEPGDPGVPGPVGMKGLSGDRGDAGMSGERGHPGSPG
FKGMAGMPGIPGQKGDRGSPGMDGFQGMLGLKGRQGFPGTKGEAGFFGVPGLKGLPGEPG
VKGNRGDRGPPGPPPLILPGMKDIKGEKGDEGPMGLKGYLGLKGIQGMPGVPGVSGFPGL
PGRPGFIKGVKGDIGVPGTPGLPGFPGVSGPPGITGFPGFTGSRGEKGTPGVAGVFGETG
PTGDFGDIGDTVDLPGSPGLKGERGITGIPGLKGFFGEKGAAGDIGFPGITGMAGAQGSP
GLKGQTGFPGLTGLQGPQGEPGRIGIPGDKGDFGWPGVPGLPGFPGIRGISGLHGLPGTK
GFPGSPGVDAHGDPGFPGPTGDRGDRGEANTLPGPVGVPGQKGERGTPGERGPAGSPGLQ
GFPGISPPSNISGSPGDVGAPGIFGLQGYQGPPGPPGPNALPGIKGDEGSSGAAGFPGQK
GWVGDPGPQGQPGVLGLPGEKGPKGEQGFMGNTGPSGAVGDRGPKGPKGDQGFPGAPGSM
GSPGIPGIPQKIAVQPGTLGPQGRRGLPGALGEIGPQGPPGDPGFRGAPGKAGPQGRGGV
SAVPGFRGDQGPMGHQGPVGQEGEPGRPGSPGLPGMPGRSVSIGYLLVKHSQTDQEPMCP
VGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASRNDKSY
WLSTTAPLPMMPVAEEEIKPYISRCSVCEAPAVAIAVHSQDTSIPHCPAGWRSLWIGYSF
LMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYFANKYSFWLTTIPEQNFQ
STPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5124 nt   +upstreamnt  +downstreamnt
atggaccgagtgcggttcaaagcgtctggccctcccctgcgagggtggctgctgctagca
actgtgacagtgggactcctggctcagagcgtcttggggggtgtgaagaagttggatgtg
ccctgcggagggagagactgcagtgggggttgccagtgctacccggagaaaggagcaagg
ggtcagccaggggcagtgggcccccaggggtacaatggccccccagggttgcaaggattc
ccaggactacagggccgcaaaggagacaagggcgaacggggagttcctggaccaactgga
ccaaaaggagatgtgggagcgagaggcgtctctggattccccggtgcagatggaattcct
gggcatccagggcaaggcggaccccgaggaaggccaggctacgatggttgcaacggaacc
aggggagacgcgggtccacaggggccctctggatctgggggcttccctggcctccctggg
ccccaaggacccaaggggcagaaaggcgagccttacgcactctctaaagaagaccgtgac
aaataccggggtgaacctggagagcctggcctggttggctaccagggacctcctggccgc
ccagggcccataggacagatgggtcccatgggagcacctggaagaccgggaccaccggga
ccccctggacccaagggacaaccaggcaaccgagggctcggtttttacggacagaagggt
gaaaagggtgacataggacagccaggacccaacgggatcccatctgacatcacacttgtt
gggcccacaacatcaacgatccacccggatctgtacaagggtgaaaaaggagacgaagga
gagcaagggatacccggcgtaatctcaaaaggcgaggaaggcatcatggggttcccagga
atacggggttttcctggccttgatggagaaaaaggagtcgtaggacagaaaggaagcaga
ggcctggatggtttccaaggccccagtggacctcgaggacccaagggagaacggggggaa
caaggacccccaggaccctctgtctactcgccccatccatccctggcaaaaggtgcccga
ggtgacccaggattccaaggtgctcatggggagccaggaagccgaggcgaaccgggagag
cctggaaccgcgggtcctccaggcccatccgtcggagatgaagattcaatgagaggcctt
ccaggggagatgggacccaaaggcttctcaggagaaccagggtcccctgcacgctatctt
ggcccaccaggagcagatggaagaccaggtccccaaggagtccctggacctgcaggccca
cctggaccagatggcttcctgtttggcctgaaaggatcagaagggagagtgggctacccg
ggaccttcaggtttcccaggaacacgagggcagaaaggatggaaaggtgaagctggagac
tgccaatgtggccaggtcatcgggggtcttccgggactgccaggacccaaaggttttccc
ggtgtcaatggggagctcggaaagaaaggcgaccaaggagacccaggcctgcacggtatc
cctgggttcccaggattcaagggagccccgggcgttgctggagctcctggacccaaagga
ataaagggagactctagaacaatcaccaccaaaggggagcgaggacagccaggtatccct
ggtgtacacggaatgaaaggtgatgacggcgtcccaggacgggatgggctggatggattc
cctggcctgcctggccccccgggcgatggcatcaaaggccctccaggggatgcaggtctc
cctggtgtacccggaaccaagggctttccaggagacatcggtcctccaggacagggctta
ccaggtccgaaaggcgagcgtggtttccctggagacgctgggttgcctggacctccgggc
ttccctggtcctccaggtcccccaggaaccccaggacagagagattgtgacacgggtgtg
aaaagacctatcggaggcggccagcaagtggtcgttcagccaggttgcattgaaggcccc
acaggatcacctggccagccaggacccccaggccccacaggtgccaaaggcgtcagagga
atgccaggattcccaggagcttctggagaacaagggctcaagggctttccaggagaccca
ggtcgagaaggcttcccagggcccccagggttcatgggaccccgaggatccaaaggtacc
acaggcctccctggcccagatggacccccaggccccattggacttccaggaccagctgga
ccccctggggacagagggattccaggagaagtgctaggggcccagcctgggacacgagga
gatgctggacttccaggacagcctgggctgaaagggctcccaggagaaacaggagcaccg
ggattcagaggaagccaagggatgcccgggatgccagggcttaaaggtcagccaggcttc
ccaggaccttcgggacagccaggacagtctgggcccccaggacaacatggattcccagga
actcctggccgagaggggcctttggggcagccaggctcccctggccttggaggtttgcct
ggagacaggggcgagcctggtgaccctggtgtccctggccctgtgggcatgaaaggtctg
tctggggacagaggtgacgccggtatgtcaggcgagcgtggtcaccctggaagccctgga
tttaaaggaatggcagggatgcctggtatccctgggcagaaaggtgatcgagggtcgcct
ggaatggacggtttccagggcatgttgggacttaagggaagacagggcttcccagggacc
aaaggagaagctggattttttggagttcctggtttgaagggcctgcctggcgagccaggg
gttaaaggaaaccgaggagaccgggggcccccaggaccacctcctctcatcctgccgggg
atgaaggacatcaagggagaaaagggagatgaaggaccaatgggcctgaaagggtatctg
ggcttaaaaggcatccaaggaatgcccggagtccccggagtgtctggattccctgggcta
cctggaaggcctggcttcatcaaaggagtcaagggagacatcggagtccctggcacacca
ggcttgccgggattccctggggtgtctggccctcctggaattaccgggtttccaggattc
acaggcagccggggcgagaagggtactccaggagtagcaggagtttttggcgagaccggc
cctactggggactttggtgacattggggacactgtggacttaccagggagcccaggcctg
aagggggaacggggcatcacgggaattccaggtctcaagggattctttggagagaaagga
gctgcgggtgacattggatttcctgggataacgggcatggctggagctcagggctctcct
ggacttaaaggacagacaggctttccagggctcacagggctgcaagggccacagggagag
cctggacggatcggaatacccggtgacaagggtgatttcggctggccaggcgtaccaggt
ctaccaggttttcctgggatccggggcatcagcggattgcacggcctgccaggcaccaaa
ggcttccctggatcaccaggtgttgatgctcatggagacccagggttcccaggccccact
ggagacaggggtgaccggggagaggccaacacacttccaggccccgtgggagttccaggg
cagaaaggggagcggggaaccccaggggaacgtggcccagctggaagcccaggacttcag
ggtttccctggtatctctccaccatccaacatctctgggtcacctggtgatgtaggcgca
ccaggaatatttggcttgcaaggctaccaaggccctccaggaccacctgggccaaacgca
cttcctggaatcaaaggagatgaggggagctctggagctgcaggattccctggacagaaa
ggatgggttggggacccagggccccagggccagcctggtgtactcggtcttccgggggag
aaagggcccaagggtgaacaaggattcatgggcaacaccgggccctctggggccgtgggt
gacagaggccccaaaggacccaaaggcgaccaaggattcccaggtgctcctggctctatg
gggtccccaggaattcctggcatcccccagaagattgctgtccagcctggaacgctgggt
ccccagggcaggagaggccttcctggggccctgggagagatagggccgcagggccctcct
ggagatccaggcttccgtggggccccaggcaaggctgggcctcagggcagaggtggcgtg
tctgctgttccagggttccggggagaccaagggcccatgggacaccagggtccagttggc
caggaaggggagccaggccgtccagggagcccaggcctgccagggatgccaggccgcagt
gtgagcatcggctacctcctggtgaagcacagccaaacggaccaggaacccatgtgccct
gtgggcatgaacaagctctggagtgggtacagcctgctatattttgagggccaggagaaa
gcgcacaaccaggacctaggactggcaggctcctgcctggcacgcttcagcaccatgcct
ttcctgtactgcaatccgggtgacgtctgctactatgccagccgcaacgacaagtcctac
tggctctccaccacggcccctctgcccatgatgcccgtggctgaggaggaaatcaagccc
tacatcagccgctgctctgtgtgcgaggctccggccgtggccattgccgtgcacagccag
gatacctctataccccactgcccggctgggtggcggagtttgtggatcggatattcattc
ctcatgcacactgcagccggggatgaaggcggtggccagtcactggtgtcgccgggcagc
tgtctagaggacttccgtgcaacgccatttatcgagtgtaacgggggccgtggtacctgc
cactacttcgctaacaagtacagcttctggctgaccacgatcccagagcagaacttccag
agcacaccatccgctgacacgctcaaggctggcctcatccgcacgcacatcagccgctgc
caagtgtgcatgaagaatctgtga

KEGG   Mus musculus (mouse): 12828
Entry
12828             CDS       T01002                                 

Gene name
Col4a3, [a]3(IV), alph, alpha3(IV), tumst
Definition
(RefSeq) collagen, type IV, alpha 3
  KO
K06237  collagen type IV alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12828 (Col4a3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12828 (Col4a3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12828 (Col4a3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12828 (Col4a3)
  09154 Digestive system
   04974 Protein digestion and absorption
    12828 (Col4a3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12828 (Col4a3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12828 (Col4a3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12828 (Col4a3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12828 (Col4a3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12828 (Col4a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12828 (Col4a3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12828 (Col4a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12828 (Col4a3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12828 (Col4a3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 12828
NCBI-ProteinID: NP_031760
MGI: 104688
Ensembl: ENSMUSG00000079465
Vega: OTTMUSG00000021696
UniProt: Q9QZS0
Position
1; 1 C5
AA seq 1669 aa
MHSKTAPRFLVFLLLTLLLLLAASPVASKGCVCKGKGQCLCAGTKGEKGEKGVPGSPGFP
GQKGFPGPEGLPGPQGPKGSPGLPGLTGPKGIRGITGLPGFAGPPGLPGLPGHPGPRGLA
GLPGCNGSKGEQGFPGFPGTPGYAGLPGPDGLKGQKGEPAQGEDRGFNGKGDPGPPGVPG
FQGFPGLPGFPGPAGPPGPPGFFGLPGAMGPRGPKGHMGDSVIGQKGERGMKGLTGPPGP
PGTVIFTLTQPYNKSDFKGEKGDEGERGEPGPPGPSGPPGDSYGSEKGAPGEPGPRGKPG
KDGAPGFPGTEGAKGNRGFPGLRGEAGIKGRKGDIGPPGFPGPTEYYDAYLEKGERGMPG
LPGPKGARGPQGPSGPPGVPGSPGLSRPGLRGPIGWPGLKGSKGERGPPGKDTVGPPGPL
GCPGSPGPPGPPGPPGCPGDIVFKCSPGEHGMPGDTGPPGVPGLDGPKGEPGSPCTECHC
FPGPPGVPGFPGLDGIKGIPGGRGVPGLKGNPGSPGSAGLPGFAGFPGDQGHPGLKGDKG
DTPLPWGQVGNPGDPGLRGLPGRKGFDGTPGGPGAKGPPGPQGEPALSGRKGDQGPPGPP
GFPGPPGPAGPAGPPGYGPQGEPGPKGAQGVPGVLGPPGEAGLKGEPSTSTPDLGPPGPP
GPPGQAGPRGLPGLPGPVGKCDPGLPGPDGEPGIPEAGCPGPPGPKGNQGFPGTKGSPGC
PGEMGKPGRPGEPGIPGAKGEPSVGRPGKPGKPGFPGERGNAGENGDIGLPGLPGLPGTP
GRGGLDGPPGDPGQPGSPGAKGSPGRCIPGPRGTQGLPGLNGLKGQPGRRGDTGPKGDPG
IPGMDRSGVPGDPGPPGTPGCPGEMGPPGQKGYPGAPGFPGPPGEKGEVGMMGYPGTTGP
PGLPGKPGSQGQRGSLGIPGMKGEKGRPGAKGERGEKGKPGPSQTTLLKGDKGEPGLKGF
VGNPGEKGNRGNPGLPGPKGLEGLPGLPGPPGPRGDTGSRGNPGRPGPHGMPGSMGIMGV
PGPKGRKGTSGLPGLAGRPGLTGIHGPQGDKGEPGYSEGARPGPPGPKGDPGLPGDKGKK
GERGVPGPPGQSGPAGPDGAPGSPGSPGHPGKPGPAGDLGLKGQKGFPGPPGSTGPPGPP
GLPGLPGPMGMRGDQGRDGIPGPPGEKGETGLLGAYPGPKGSPGVPGAKGDRGVPGLSGL
PGRKGVMGDVGPQGPPGTAGLPGPPGLPGAIIPGPKGDRGLPGLRGNPGEPGPPGPPGPI
GKGIKGDKGFMGPPGPKGLPGTVGDMGPPGFPGAPGTPGLPGVRGDPGFPGFPGIKGEKG
NPGFLGPIGHPGPVGPKGPPGPRGKPGTLKVISLPGSPGPPGVPGQPGMKGDPGPLGLPG
IPGPCGPRGKPGKDGKPGTPGPAGTKGNKGLKGQQGPPGLDGLPGLKGNPGDRGTPATGT
RMRGFIFTRHSQTTAIPSCPEGTQPLYSGFSLLFVQGNKRAHGQDLGTLGSCLQRFTTMP
FLFCNINNVCNFASRNDYSYWLSTPALMPMDMAPISGRALEPYISRCTVCEGPAMAIAVH
SQTTAIPPCPQDWVSLWKGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGT
CNYYSNSYSFWLASLNPERMFRKPIPSTVKAGDLEKIISRCQVCMKKRH
NT seq 5010 nt   +upstreamnt  +downstreamnt
atgcactccaagactgctccaaggttcctggtgttcctgctgcttaccctgctgctactc
ctggctgcctctcctgtggctagcaagggctgtgtctgcaaaggcaaaggacaatgcctc
tgcgcggggaccaaaggggagaagggggagaaaggggttcctggttcccctggatttcct
ggccagaaaggatttccaggtcctgaaggcttgcctggaccacagggacccaagggctcc
ccaggacttccgggactcactggccccaaaggcatcaggggaataactggattaccaggg
tttgcaggtcctcctggacttccaggcctcccaggccaccctgggcctcgtgggctggct
ggtttaccaggatgcaacggatctaagggtgaacaaggattcccgggctttcccggcaca
ccaggctatgcagggctcccaggtcctgatggcttgaaaggacaaaagggtgagcctgct
caaggagaagacaggggattcaatggaaaaggtgaccctgggcctccaggggttccaggc
ttccagggttttccgggactcccaggttttccagggcctgccggtccaccaggacctccg
ggattttttggtttaccaggagcaatgggacccagaggacccaaaggccacatgggcgat
agcgtgataggacaaaaaggagaaaggggtatgaaaggattaacaggacctcctgggcca
ccaggaacagtgatttttacactcacccagccatacaacaaatcggacttcaagggagag
aaaggagatgagggagagaggggtgaacccggacctcctggaccctcggggccacctgga
gactcctatggatcagaaaagggtgcgcctggagagcctggtcctcggggcaaacctgga
aaagatggtgcccctggcttccctggcactgagggagccaaaggcaacaggggctttcct
gggttgaggggtgaagctggcattaagggaaggaaaggagacattggccccccaggattt
cctggtccaacagaatattatgacgcatacctggaaaagggagagagaggaatgccaggc
cttcctgggcccaaaggagcccgtggcccacagggtccaagtggtccccctggagtccct
ggaagtcctggactgtcaaggcctggcctcagaggacccattggatggccaggcttgaaa
gggagtaaaggagagagaggaccccctggaaaagacactgtgggccctcctggacccctg
ggatgtcctggctcaccaggtccaccaggccctccaggacctccaggatgtccaggtgac
attgtttttaaatgttcccctggtgagcatggaatgccaggtgacacaggacctccagga
gttccaggacttgatggacccaaaggagaaccaggcagtccatgcaccgagtgtcactgc
ttcccagggccccctggagtcccaggatttccaggattagatggtatcaaaggaatccca
ggaggacgaggtgtgcctggtctgaagggaaacccagggtccccaggaagtgcaggtctc
ccaggatttgcaggattcccaggtgaccaagggcatccaggacttaaaggggacaaaggg
gatacacctctaccctgggggcaagtgggtaatccaggtgatcctggactcagaggcctg
cccgggagaaagggcttcgatggaactcctggaggtccaggagcgaaaggaccaccagga
cctcagggcgaaccggccctgagtggaaggaaaggggaccaaggacctccaggacctcct
ggattccctggacccccaggacctgcaggaccagctggaccaccaggctatggacctcaa
ggagagccaggtccaaagggagcccaaggagtccccggcgtcctgggaccacctggagaa
gccggtcttaaaggagaacccagtacatcaactccagatctaggtcccccaggccctcca
gggccccctggtcaggctggccccagaggtctacctggtttgcctggaccggtgggaaaa
tgtgatcctggtcttcctggacctgatggtgagccaggaattccagaagctggatgccca
gggcctccaggacctaagggaaatcaaggtttcccagggacaaaaggatcacctggttgt
cctggggaaatgggaaagcctggccgtcctggagaaccaggcatcccaggagccaaggga
gaaccatccgtaggcaggcctgggaaaccagggaaaccaggctttccaggagaaagaggc
aatgctggggaaaatggagatattggactccctgggcttccaggcctccctggaactcca
ggaagaggcgggcttgacgggcctccaggagacccaggacagcctggatcacctggagca
aaaggatccccaggaaggtgcataccaggacccaggggcacccaaggacttcccggcttg
aatggattgaaagggcaaccaggtcgaagaggtgataccgggccaaagggagaccctggc
atcccaggcatggacaggtctggggtccccggagatcctggaccaccaggaacaccaggt
tgtcctggtgagatgggaccacctggacaaaaaggatatccgggagctccaggattccca
ggaccaccaggcgagaaaggagaggttggaatgatgggctatcctggaaccactggccct
ccggggcttcctgggaaaccaggctcacaggggcagcgaggtagcctcggaatcccagga
atgaaaggggaaaaaggacgcccaggagccaaaggcgaacgaggagagaaaggaaaacca
gggccttctcaaacaacactcttaaagggagacaaaggagagcctggacttaaaggattt
gttgggaatccaggtgagaaaggaaacagaggcaacccagggttaccaggtccgaaaggc
ctcgagggattgcctgggctaccaggtcctccaggccctagaggagatacgggaagcaga
ggaaatcctggaagaccaggaccacacggcatgccaggaagcatggggatcatgggggtg
ccaggccctaaagggagaaaaggaacttcagggcttccaggtctagctggaagaccaggc
ctgacagggatccatggtccccaaggagataagggggagccgggttattcagaaggtgca
agaccaggaccaccaggaccaaagggcgatccaggattgccaggtgacaaaggaaagaaa
ggagaaagaggcgtacctgggccacctggacaatcggggcctgccggacctgatggagcc
cctgggagtcctgggagtcctggtcacccaggaaaaccaggtcctgctggtgatttgggt
ctgaaaggacagaaaggcttcccaggccctccaggaagcactggccctccaggccctcca
ggactcccaggacttcctgggccaatgggtatgagaggtgaccaaggacgtgatggaatt
cctggtcctccaggagaaaaaggagaaacaggcttgctgggggcctacccaggcccaaaa
gggagccctggtgtaccaggtgccaaaggagacaggggagttccaggcttgtctggcctt
cccggcaggaagggggttatgggggatgttggaccccaaggacccccaggcactgctgga
ctcccagggccaccaggtctacctggggcaattatccctggccccaaaggagacagaggt
cttcctggcttaagaggaaatccaggtgagccaggtccccctggacctccaggacctatc
ggaaaaggcataaaaggtgacaaaggatttatgggcccacctggccccaaaggcctgcct
ggaactgtaggggacatgggcccaccaggtttcccgggagcaccaggtacccccggtctt
cccggtgtcagaggtgatccaggattccctggatttccaggcataaaaggagaaaagggt
aaccctggatttcttgggccaattggacatccaggaccagttgggcccaaaggaccacca
ggtccacgtggaaaacctggcactcttaaggtcatctctcttccgggaagcccagggcca
cctggtgtacctggacagccaggaatgaaaggagaccctggacccctgggactgccagga
atcccaggaccctgtgggccaagaggtaaaccaggcaaggatgggaaaccaggaactcca
ggaccagctggtacaaagggcaacaagggcttgaaaggacagcaaggcccacctggtctg
gatggattgccaggcttaaagggaaatcctggtgacaggggaacgccggccactggtaca
agaatgcgaggcttcatcttcacccgacacagtcaaaccacggccattccttcatgccct
gaaggaacacagccactctatagtgggttttctcttctttttgtacaaggaaacaaacgt
gcacatggacaagacctaggtactctgggcagctgcctgcagcgattcaccacaatgccg
ttcttattctgtaacatcaataatgtatgtaactttgcatcacgaaatgattattcatac
tggctgtcaacaccagctctgatgccaatggacatggctccaattagtggcagagctctc
gaaccctatattagcagatgcaccgtctgtgaaggtccagcaatggccatagctgttcac
agtcaaactactgctatccctccgtgtccccaggactgggtttctctctggaaaggtttt
tctttcattatgttcacaagtgcaggctctgagggtgctggacaagcacttgcctcgcct
ggctcctgcctggaagaattccgagccagtccatttatagaatgccatggacgagggaca
tgtaactactactcaaactcctacagtttctggctggcttcgctgaacccagaaagaatg
ttcagaaaacctattccatcaactgtgaaagctggagacttagagaaaatcataagccgc
tgtcaggtgtgcatgaagaaaagacattga

KEGG   Mus musculus (mouse): 12829
Entry
12829             CDS       T01002                                 

Gene name
Col4a4, E130010M05Rik, [a]4(, [a]4(IV)
Definition
(RefSeq) collagen, type IV, alpha 4
  KO
K06237  collagen type IV alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12829 (Col4a4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12829 (Col4a4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12829 (Col4a4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12829 (Col4a4)
  09154 Digestive system
   04974 Protein digestion and absorption
    12829 (Col4a4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12829 (Col4a4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12829 (Col4a4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12829 (Col4a4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12829 (Col4a4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12829 (Col4a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12829 (Col4a4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12829 (Col4a4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12829 (Col4a4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12829 (Col4a4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 12829
NCBI-ProteinID: NP_031761
MGI: 104687
Ensembl: ENSMUSG00000067158
Vega: OTTMUSG00000021695
UniProt: Q9QZR9
Position
1; 1 C5
AA seq 1682 aa
MRCFFRWTKSFVTAPWSLIFILFTIQYEYGSGKKYGGPCGGRNCSVCQCFPEKGSRGHPG
PLGPQGPIGPLGPLGPIGIPGEKGERGDSGSPGPPGEKGDKGPTGVPGFPGVDGVPGHPG
PPGPRGKPGVDGYNGSRGDPGYPGERGAPGPGGPPGQPGENGEKGRSVYITGGVKGIQGD
RGDPGPPGLPGSRGAQGSPGPMGHAGAPGLAGPIGHPGSPGLKGNPATGLKGQRGEPGEV
GQRGPPGPTLLVQPPDLSIYKGEKGVKGMPGMIGPPGPPGRKGAPGVGIKGEKGIPGFPG
PRGEPGSHGPPGFPGFKGIQGAAGEPGLFGFLGPKGDLGDRGYPGPPGILLTPAPPLKGV
PGDPGPPGYYGEIGDVGLPGPPGPPGRPGETCPGMMGPPGPPGVPGPPGFPGEAGVPGRL
DCAPGKPGKPGLPGLPGAPGPEGPPGSDVIYCRPGCPGPMGEKGKVGPPGRRGAKGAKGN
KGLCTCPPGPMGPPGPPGPPGRQGSKGDLGLPGWHGEKGDPGQPGAEGPPGPPGRPGAMG
PPGHKGEKGDMVISRVKGQKGERGLDGPPGFPGPHGQDGGDGRPGERGDPGPRGDHKDAA
PGERGLPGLPGPPGRTGPEGPPGLGFPGPPGQRGLPGEPGRPGTRGFDGTKGQKGDSILC
NVSYPGKPGLPGLDGPPGLKGFPGPPGAPGMRCPDGQKGQRGKPGMSGIPGPPGFRGDMG
DPGIKGEKGTSPIGPPGPPGSPGKDGQKGIPGDPAFGDPGPPGERGLPGAPGMKGQKGHP
GCPGAGGPPGIPGSPGLKGPKGREGSRGFPGIPGSPGHSCERGAPGIPGQPGLPGTPGDP
GAPGWKGQPGDMGPSGPAGMKGLPGLPGLPGADGLRGPPGIPGPNGEDGLPGLPGLKGLP
GLPGFPGFPGERGKPGPDGEPGRKGEVGEKGWPGLKGDLGERGAKGDRGLPGDAGEAVTS
RKGEPGDAGPPGDGGFSGERGDKGSSGMRGGRGDPGRDGLPGLHRGQPGIDGPPGPPGPP
GPPGSPGLRGVIGFPGFPGDQGDPGSPGPPGFPGDDGARGPKGYKGDPASQCGPPGPKGE
PGSPGYQGRTGVPGEKGFPGDEGPRGPPGRPGQPGSFGPPGCPGDPGMPGLKGHPGEVGD
PGPRGDAGDFGRPGPAGVKGPLGSPGLNGLHGLKGEKGTKGASGLLEMGPPGPMGMPGQK
GEKGDPGSPGISPPGLPGEKGFPGPPGRPGPPGPAGAPGRAAKGDIPDPGPPGDRGPPGP
DGPRGVPGPPGSPGNVDLLKGDPGDCGLPGPPGSRGPPGPPGCQGPPGCDGKDGQKGPMG
LPGLPGPPGLPGAPGEKGLPGPPGRKGPVGPPGCRGEPGPPADVDSCPRIPGLPGVPGPR
GPEGAMGEPGRRGLPGPGCKGEPGPDGRRGQDGIPGSPGPPGRKGDTGEAGCPGAPGPPG
PTGDPGPKGFGPGSLSGFLLVLHSQTDQEPACPVGMPRLWTGYSLLYMEGQEKAHNQDLG
LAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLSSAAPLPMMPLSEEEIRSYISRCAV
CEAPAQAVAVHSQDQSIPPCPRTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRA
APFVECQGRQGTCHFFANEYSFWLTTVNPDLQFASGPSPDTLKEVQAQRRKISRCQVCMK
HS
NT seq 5049 nt   +upstreamnt  +downstreamnt
atgaggtgctttttcagatggaccaagtcctttgtcacagccccctggtcactaatattt
atcctctttactatacaatatgaatatgggagtggcaagaagtatggcggcccctgcgga
ggaagaaactgctctgtctgccagtgttttcctgagaagggatctcggggtcacccagga
ccactgggaccacagggaccaatagggcccttgggacccctgggacctattgggattcca
ggagaaaaaggagagagaggagacagtggctcacctggaccaccaggagagaaaggagac
aagggtccaactggtgtccctggatttccaggtgtggatggtgtacctggtcacccaggg
cctcctggacccagaggcaaacctggtgtggacggctacaatggctcacgtggtgatccg
ggctatccaggagaaagaggagctccaggcccaggcggcccccctggtcagcctggggaa
aatggagaaaaaggaagatctgtgtacattactggtggcgttaaaggtattcagggagac
cgtggggacccaggaccacccggcttaccaggatctaggggtgcacaagggtcaccaggg
cccatggggcatgcaggcgcaccagggctagcaggacctataggtcatcctggaagccct
gggttgaagggaaatcctgccactggactgaagggacaaaggggagagccgggtgaagtt
ggccagcgtggtcctcctgggcccacgctgttggtacagccgcctgatttgagtatctat
aaaggagaaaagggtgtaaaaggaatgcctggaatgattggtcccccaggacctccaggt
cgcaagggagcgcctggtgtcgggatcaaaggagagaaaggtatccctgggttcccagga
ccccggggtgagcctggttcgcatgggcctccaggttttccaggattcaaggggatacaa
ggagcagctggagagcctgggctgttcggatttcttggtccaaagggggatctgggagat
cgcgggtacccgggaccaccaggcattttgttgactccagctccaccactcaaaggtgtt
ccaggggacccaggaccccctggctactatggggagattggagatgttggattaccaggt
cctccagggcccccaggcagaccaggggaaacttgtccaggcatgatgggacctcctgga
ccaccaggggttcctggtcctccaggatttccaggagaagctggggttcctggaagactc
gactgtgccccaggaaaacctgggaagccagggctacccggcctgcctggcgcaccagga
ccagaggggccccctggatcagatgtgatatactgtcgccctgggtgccctgggccaatg
ggtgaaaagggaaaagtgggtcctccaggaagaagaggagccaaaggagcaaaaggaaac
aagggactctgtacctgtccacctggtcccatgggaccccctggtcccccaggacctcct
ggaagacaaggaagtaaaggagacttagggctccctggttggcatggagaaaagggcgat
ccaggtcagcctggtgctgaaggaccgccagggccaccaggaagacctggtgccatgggg
ccccctggtcacaaaggggaaaagggtgacatggtcatatcaagagtgaaagggcaaaaa
ggagaaagaggactggatgggccaccaggatttccggggccacatggacaagatggtggg
gatggacgtcctggagaaagaggggatcctgggccacgaggggaccataaggatgcagcc
ccgggtgagagagggcttcccggactgccaggccctccaggaagaacaggacctgagggg
cctccaggcctgggatttccaggcccaccaggacagcgaggcctacccggagagcccggg
cgtccgggcaccagaggctttgatggcacgaaggggcagaaaggtgactccattctgtgt
aatgtaagctacccgggaaaaccaggtctgccaggtcttgatggacctccaggtctgaag
gggtttccaggccccccaggggctcctggtatgagatgtccagatgggcagaaaggccag
cggggcaaaccgggaatgtctgggattccaggtccacctggttttcgtggtgacatggga
gatccaggcatcaaaggtgaaaaggggacctcccctattggacccccaggcccacctggg
tctcctggaaaggatggccagaaaggaatcccaggagaccctgcatttggtgacccagga
ccccctggagagaggggtcttccaggagcaccaggcatgaaaggacagaaaggtcaccca
gggtgcccaggggctggaggccctcctggcatccctggatctccaggtctcaaaggtccc
aaaggtagagagggaagtcgtggctttccagggatcccaggatcccctggccattcctgt
gaaagaggtgctcccgggatcccaggacaaccgggacttcctggaactccaggtgatcca
ggggccccaggttggaaaggccagccaggagacatgggtccctctggaccagctgggatg
aagggcctccctggtctcccaggcctaccaggagctgatggtctccgagggcctcctggg
attccaggccccaatggggaagatggtctacctggtcttccaggcctgaagggactccca
gggctgcctggcttccctggttttccaggagagagaggaaagccagggccagatggagaa
cctggaagaaagggagaggttggagagaaaggctggcctggcttgaagggagacctggga
gagcgaggcgccaaaggagacagaggacttcctggtgatgcaggagaagcagtcacttcc
agaaagggtgaacctggggatgctgggcctccaggagatggtgggttctcaggagagaga
ggtgataaaggaagctcagggatgcgagggggaagaggggatcccggaagagatggacta
ccgggactccacagagggcagcctgggatagatgggcctcctgggcctcctgggccccct
ggccctccaggatcacctggactgagaggagtcattggtttcccaggatttccaggtgac
cagggtgatccaggttctccaggaccccctggattcccaggagatgatggagcaagagga
cctaaaggatacaaaggtgaccctgccagtcagtgtggtccacctggtccaaagggtgag
ccaggtagtcctggataccaaggacgtactggagtccccggagagaaaggctttcctgga
gatgaaggaccccgaggaccaccaggcagacctggacagcctggatcttttggaccacca
gggtgtccaggtgacccagggatgcccggactcaagggacatccaggagaagtgggagac
cctgggccaagaggtgatgcgggagatttcgggaggccaggtcctgctggagtgaaaggg
cctctcgggtctcctggtctgaatggcttacatggtctgaagggtgagaaaggaacaaaa
ggcgcctcaggtttgctcgaaatgggtccacctgggccaatggggatgcctgggcaaaaa
ggagagaaaggagaccctgggagtccagggatttctcctccaggtcttcctggagaaaag
ggcttcccaggacccccagggagaccaggaccacctggtcccgcaggtgccccaggaaga
gctgctaaaggtgacattcctgatccaggtccacctggagaccggggacctcctggcccc
gatggcccaagaggagtacctgggcctccgggttcccctgggaatgttgaccttctgaaa
ggggacccaggtgactgtggtttgccaggaccacctggctcccgaggcccaccaggccct
ccagggtgtcagggtcccccaggatgtgatggcaaagatggccagaaaggaccaatggga
cttccagggttgccagggccacctggtcttcctggggcacctggcgagaagggattacct
ggccctccaggcagaaaagggccagtaggtcctccaggctgcagaggtgaacctgggcct
cctgcagacgtggattcctgtcctcgaatcccaggacttcctggagtgccaggtcccaga
ggaccagaaggagctatgggggaacctggacggagaggcctgcctggaccagggtgcaaa
ggagagcctggaccggatggcagacggggccaggatggcatccctggatctcccgggcct
cctggacgcaaaggtgacactggagaggcagggtgtcctggagcaccaggccctcctggt
ccaactggtgatcctgggcccaaggggtttggccctggatcgctcagtggcttcctcctg
gttctccacagtcagactgaccaggaaccggcctgccccgtgggcatgcctcggctttgg
acagggtacagcttgttgtacatggaaggacaggagaaggcgcacaatcaagatcttggt
ttggcaggctcttgtcttcctgtgtttagcactctgccctttgcctactgcaacatccac
caagtgtgccactacgcccagagaaatgacaggtcctactggctgtccagtgcggctcct
cttcctatgatgccactctcagaggaagagatccgctcttacatcagccgctgtgcggtg
tgtgaggccccagcacaggccgtggcggtccacagtcaggaccaatccatcccaccgtgt
ccacggacatggaggagtctctggattgggtactcatttctgatgcacactggagctggg
gaccaaggaggtgggcaggcactgatgtcacctggcagctgcctagaggacttcagagct
gcaccgttcgttgaatgccagggccgacagggaacctgtcacttttttgcaaacgagtac
agcttctggctgaccaccgtgaacccagacctgcagtttgcctctggcccgtcaccagac
accttgaaagaagttcaggcccagcgccggaaaatcagcaggtgccaggtttgcatgaag
cacagctaa

KEGG   Mus musculus (mouse): 12830
Entry
12830             CDS       T01002                                 

Gene name
Col4a5
Definition
(RefSeq) collagen, type IV, alpha 5
  KO
K06237  collagen type IV alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12830 (Col4a5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12830 (Col4a5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12830 (Col4a5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12830 (Col4a5)
  09154 Digestive system
   04974 Protein digestion and absorption
    12830 (Col4a5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12830 (Col4a5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12830 (Col4a5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12830 (Col4a5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12830 (Col4a5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12830 (Col4a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12830 (Col4a5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12830 (Col4a5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12830 (Col4a5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12830 (Col4a5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 12830
NCBI-ProteinID: NP_001156627
MGI: 88456
Ensembl: ENSMUSG00000031274
Vega: OTTMUSG00000018954
UniProt: Q63ZW6
Position
X F2; X 62.16 cM
AA seq 1691 aa
MQVRGVCLAAGWFLLALCLWGQPAEAAACHGCSSGSKCDCSGIKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSPLPGPKGNQGYPGPPG
IQGPPGPKGISGPSGPPGPPGLMGPPGPPGPPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPIDIEFQKGDQGVPGDRGPPGPPGIPGPPGPPGGVKGEKGEPGEAGKRGKP
GKDGETGQPGIPGLPGDPGYPGEPGRDGEKGQKGDIGPPGPPGLVIPAPGTGVTMGEKGN
IGLPGLPGEKGERGFPGIQGPPGFPGPPGTAVVGPPGPPGYPGERGQKGDEGPPGICIPG
SPGLDGQPGAPGLPGPPGPPGPQLPSRDEICKAGPPGPPGPPGDKGLQGERGVKGDKGDT
CFNCIGTGISGPPGQPGLPGLPGPPGSLGIPGEKGDKGQAGITGPKGLPGIPGPPGAPGF
PGSKGDPGDVLTLPGMKGDKGELGFPGAPGLPGLPGSPGKDGLPGLPGPKGEPGGITFKG
ERGPPGSPGLPGLPGNMGPTGPVGFGPPGPIGEKGIQGVAGNPGQPGLPGPKGDPGQTIT
QPGKPGLPGSPGRDGEVGLPGDPGLPGQPGLPGIPGSKGEPGIPGIGPPGPPGPKGFPGI
PGPPGAPGAPGRMGPDGPPGPPGFPGPKGEPGFGLPGPPGPPGFPGFKGTPGPKGDRGFP
GPSGPPGRTGLDGLPGPKGDVGPNGQPGPVGPPGLPGIGLQGPPGPPGTPGPIGQPGLHG
IPGEKGDPGPPGFDVPGLPGERGSPGLPGAPGLIGPPGSPGVPGKAGVPGFPGVKGEMGM
MGPPGPPGPLGIPGRSGAPGLKGDDGMQGQPGLPGPAGEKGGKGEPGLPGPPGPMHPDFL
GSKGEKGEPGLPGIPGLSGPKGYQGLPGDPGQPGLSGQPGSPGLPGPKGNPGLPGPPGLT
GPPGPKGNIGDMGFPGPQGVDGPPGPPGFPGQPGSPGLPGQKGSKGEPGVSGIGLPGLPG
PKGEPGLPGYPGNPGIKGSVGETGLPGLPGNPGAKGQPGLPGFPGTPGLPGPKGMNGPPG
NPGFPGEPGPVGAGGRPGPPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFGIPGPPGLPGL
SGQKGDGGSPGLPGNPGLPGSKGEPGFQGFPGMPGPPGPPGSPGQALEGPKGNPGPQGPP
GRPGPPGFQGPPGTEGPRGPPGNGGIKGERGNPGPPGQPGLPGLKGDQGPPGLPGNPGRP
GLNGMKGDPGLPGVPGFPGMKGPIGVPGSTGPDGEPGLTGPPGPPGLPGPSGQSIVIKGD
PGPPGIPGQPGLKGLPGLPGPQGLPGPIGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGA
RGLDGPPGPDGLQGPPGPPGTTSVAHGFLITRHSQTTEAPQCPRGTVHIYEGFSLLYVQG
NKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMNMEPLKG
QSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGSGQAL
ASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDMSDMFNKPQSETLKAGDLRTR
ISRCQVCMKRT
NT seq 5076 nt   +upstreamnt  +downstreamnt
atgcaagtgcgtggagtgtgcctggctgccggctggttcttactggccctgtgtctgtgg
gggcagcccgcagaggctgcggcctgccatgggtgttcttctggatcaaaatgtgactgc
agtggtataaaaggagaaaagggagaacgggggtttccaggtttagaaggtcatccaggt
ttaccaggatttccaggtccagaaggccctccaggacctcggggacaaaagggtgatgat
ggaattccagggccaccaggaccaaaaggaatcagaggtcctcctggacttcctggattt
ccagggacaccaggtcttcctgggatgccaggccatgatggggctccaggacctcaaggt
atccctggatgcaatggaaccaagggagaacgtggatttccaggcagtccgggctttcct
ggtttacaaggtcctccaggacctcctgggatcccaggtatgaagggggaaccaggcagt
ataatcatgtcaccactgccaggaccaaagggtaatcaaggatacccaggtcctcctgga
atacaaggcccacctggtcccaagggtatatcagggccaagtggtcctccaggaccacca
ggtttaatgggacctcctggcccaccaggcccaccgggaccaaaggggaatatgggctta
aatttccagggacccaaaggtgaaaaaggcgaacaaggtcttcagggcccacctggtcca
cctgggcagatcagcgaacagaaaagaccaattgacatagaatttcagaaaggagatcag
ggagttcctggtgatagagggcctcctggacctccaggaatacctggtcctcccggtcct
cctggtggtgtgaaaggtgaaaagggtgagccaggagaggcaggcaaaagaggtaaacca
ggcaaagatggagagactggccaaccaggaatcccaggtttgcctggtgatcctggttac
cctggagaaccaggaagagatggtgaaaagggtcaaaagggtgatattggcccacctgga
cctcccggacttgtaattcctgcacctggaactggtgtgactatgggagaaaaaggaaat
atcgggttacctggtttgcctggagaaaagggagagcgaggatttcctggaatacaaggt
ccacctggctttcctggacctccaggaacagcagttgtgggtccccctggtcctcctgga
tatcctggtgaaaggggccagaaaggtgatgaaggtccccctggaatttgtattcctgga
tctcctggacttgatggacagcctggggctcctggccttccaggacctcctggcccccct
ggcccccagttgccatccagagatgaaatctgtaaagcaggccctcctgggcctccagga
cctccaggtgataaaggactccaaggagagcgaggagtaaaaggtgacaaaggtgatact
tgcttcaactgtattggaactggcatttcagggcctccaggccaacctggtttaccaggt
ctcccaggtcctccaggatctcttggaatccctggagagaagggggacaaaggacaagct
gggataactggtccgaaaggattgccaggcatacctggacctccaggtgctccaggcttt
ccagggtctaagggtgaccctggggatgtcctcactcttccaggaatgaaaggtgacaaa
ggagagttgggtttccctggagctccagggcttcctggtctacctggtagtcctggaaag
gatggtttgccaggactccctggccccaaaggagagcctggtggaattacttttaagggt
gaaagaggtcctcctgggagcccaggtttaccaggtctcccaggaaatatgggacctaca
ggcccagttggttttgggcctccaggccccataggcgaaaaaggcatacaaggtgtggca
ggaaatccaggccagccgggattaccaggtcctaaaggagatccaggccagaccataacc
cagccaggaaagcctggtttgccaggtagtccaggcagagatggtgaagtgggtcttcca
ggtgatcctggacttccaggccaaccaggcctgccaggaatacctggtagcaaaggagaa
ccaggtatccctgggattgggcctcctggaccacctggtcctaaaggttttccaggaatt
ccgggacctccaggagctcctggggcccctggaagaatgggtccagatgggcctcctggg
ccaccaggcttcccaggaccaaagggagagccaggatttgggttacctgggccacctggg
ccaccaggattcccaggtttcaaaggaacacctggtccaaaaggtgatcgtggtttccca
ggaccttcaggtcctccaggacgcactggcttggatgggctacctggaccaaaaggtgat
gttggaccaaatggacaacctggcccagtagggcctccagggctgccaggaattggtctt
cagggaccaccaggaccaccagggactccagggccaataggccaacctggcttacatggg
attccaggagagaagggggacccaggacctcctgggtttgatgttccaggactccctgga
gagagaggtagtccagggctccctggagcccctggtcttataggacctccaggatcacct
ggtgtccctggaaaagcaggtgtccctggatttccaggtgtcaaaggcgaaatgggtatg
atgggacctccaggcccacctggacctttgggaattcctggcaggagtggtgctcctggt
cttaaaggtgatgatggcatgcaaggtcagccaggtctccctggccctgcaggagaaaag
ggcggtaagggagagcctggccttccaggtcctcctggaccaatgcatccagatttcctg
ggatcgaaaggagaaaagggtgagcccggcttaccaggtattcctggactttcaggacca
aaaggctaccagggattacctggagacccagggcaacctggactgagtggacaaccagga
tcaccaggactcccaggtcccaagggtaatcctggtctccctggtccaccaggacttaca
ggacctcctggaccaaaaggaaacattggtgacatgggttttcctggccctcaaggtgta
gatgggccccctggacctcctggatttcctggacaacctggctctcctgggttacctggc
cagaaaggaagtaaaggagagcctggggtttcaggcattggacttccaggtcttcctggc
ccaaagggtgaacctggtctgcctggatatccaggaaacccaggtatcaaagggtcggtg
ggagagactggtcttcctggattaccaggaaaccctggagcaaaaggtcaaccgggcctg
cctggattcccaggaacaccaggacttcctggaccaaaaggtatgaatggtcctcctggt
aaccctggctttcccggagaacctggtcctgtaggtgccggagggcgtcctggaccacca
ggacctcctggtgaaaaaggcaagccaggtcaagatggcattcctgggccagcaggacaa
aagggagaaccaggtcaaccaggctttggaatcccaggacctcctggactcccaggactt
tctggacaaaagggtgatggaggatcacctggacttccaggaaatcctggccttccaggt
tcaaagggtgagccaggctttcagggattccctggtatgccaggtcccccaggtcctcct
ggttctcctggtcaagctttggaaggtcccaaaggaaaccctgggcctcaaggccctcct
gggagaccaggtcctccaggttttcaaggtccaccaggtacagaaggtcctcgtggaccc
cctggaaatggaggtatcaaaggagagaggggaaatccaggcccacctgggcagccaggc
ttacctggtttgaaaggagatcaaggaccaccaggactcccgggtaaccctggccggcca
ggtcttaatggaatgaaaggagatcctggtctccctggtgttccaggattcccaggaatg
aaaggacccattggagtaccaggctccactggccctgatggggaaccaggtcttactggg
cccccaggtcctcctgggttgcctggtccttcaggacagagtattgtaatcaaaggagat
cctggacctccagggattcctggacaacctggattaaaaggtctaccaggacttccaggc
cctcaaggcctaccaggtccaattggccctccaggagatccaggacgcaatggactccca
ggctttgatggtgcaggagggcgcaaaggagacccagggctgccaggacagccaggtgcc
cgtggattggatggtcccccaggaccagatggattgcaaggacctccaggaccccctgga
accacctctgttgcccatggattcctcatcacacgtcacagtcaaacaacagaagcacca
caatgcccacggggaacagttcatatctatgaaggcttttctctcctgtatgtacaagga
aataaaagagcccatggtcaagacttgggtacggctggcagctgccttcgtcgcttcagt
accatgcctttcatgttctgcaacattaacaacgtttgtaactttgcttcaagaaatgac
tattcttactggctttccaccccagagcccatgccaatgaacatggaacccctgaaggga
cagagcatccagccattcattagtcgatgtgcagtgtgtgaggcgccagctgtggtgatc
gctgttcacagccagactattcagattccacactgtcctcaggggtgggactctctgtgg
attggctattccttcatgatgcatacaagtgcaggagcagaaggctctggccaagcccta
gcctctcctggctcctgtttggaagaatttcgttccgctcccttcatcgaatgtcatggg
cgagggacatgcaattactatgccaattcgtacagcttttggctggccactgttgatatg
tcagacatgttcaacaaacctcagtcagaaaccctgaaagcaggagacttgaggacgcgt
attagccgatgtcaagtatgcatgaagaggacataa

KEGG   Mus musculus (mouse): 12833
Entry
12833             CDS       T01002                                 

Gene name
Col6a1, AI747156, Col6, Col6a-1
Definition
(RefSeq) collagen, type VI, alpha 1
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12833 (Col6a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12833 (Col6a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12833 (Col6a1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12833 (Col6a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12833 (Col6a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12833 (Col6a1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12833 (Col6a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12833 (Col6a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12833 (Col6a1)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   12833 (Col6a1)
SSDB
Motif
Pfam: VWA Collagen VWA_2 VWA_3 YcaO Toprim_3 ETF
Other DBs
NCBI-GeneID: 12833
NCBI-ProteinID: NP_034063
MGI: 88459
Ensembl: ENSMUSG00000001119
Vega: OTTMUSG00000020489
UniProt: Q04857 B0LAD9
Position
10 C1; 10 39.71 cM
AA seq 1025 aa
MRLAHALLPLLLQACWVATQDIQGSKAIAFQDCPVDLFFVLDTSESVALRLKPYGALVDK
VKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIRGLTRMPSGRDELKASVDAVK
YFGKGTYTDCAIKKGLEELLIGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKH
LGIKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGHSRDAEEVISQTIDTIVDMIKN
NVEQVCCSFECQAARGPPGPRGDPGYEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGMK
GEKGSRGEKGSRGPKGYKGEKGKRGIDGVDGMKGETGYPGLPGCKGSPGFDGIQGPPGPK
GDAGAFGMKGEKGEAGADGEAGRPGNSGSPGDEGDPGEPGPPGEKGEAGDEGNAGPDGAP
GERGGPGERGPRGTPGVRGPRGDPGEAGPQGDQGREGPVGIPGDSGEAGPIGPKGYRGDE
GPPGPEGLRGAPGPVGPPGDPGLMGERGEDGPPGNGTEGFPGFPGYPGNRGPPGLNGTKG
YPGLKGDEGEVGDPGEDNNDISPRGVKGAKGYRGPEGPQGPPGHVGPPGPDECEILDIIM
KMCSCCECTCGPIDILFVLDSSESIGLQNFEIAKDFIIKVIDRLSKDELVKFEPGQSHAG
VVQYSHNQMQEHVDMRSPNVRNAQDFKEAVKKLQWMAGGTFTGEALQYTRDRLLPPTQNN
RIALVITDGRSDTQRDTTPLSVLCGADIQVVSVGIKDVFGFVAGSDQLNVISCQGLSQGR
PGISLVKENYAELLDDGFLKNITAQICIDKKCPDYTCPITFSSPADITILLDSSASVGSH
NFETTKVFAKRLAERFLSAGRADPSQDVRVAVVQYSGQGQQQPGRAALQFLQNYTVLASS
VDSMDFINDATDVNDALSYVTRFYREASSGATKKRVLLFSDGNSQGATAEAIEKAVQEAQ
RAGIEIFVVVVGPQVNEPHIRVLVTGKTAEYDVAFGERHLFRVPNYQALLRGVLYQTVSR
KVALG
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgaggctggcccacgctctgctgcccctgctgctacaagcctgctgggtggccacacag
gacatccagggctccaaagcgattgccttccaagactgccctgtggatctattcttcgtg
ctcgacacctcggagagtgtggccttgaggctgaaaccttatggggccttggtggacaag
gtgaagtccttcactaagcgcttcattgacaacctgagagacaggtactaccggtgtgac
cgcaacctggtttggaatgcgggtgcgctgcactacagtgacgaggtggagatcatccga
gggctcacgcgcatgcccagtggccgcgatgagctcaaggccagcgtggatgcggtcaag
tacttcgggaaaggcacctacaccgactgcgccattaagaaggggctggaggagctgctc
atagggggctcccacctgaaggagaacaagtacttgatcgtggtgaccgacgggcatcct
ctagagggctacaaggaaccatgcgggggtctggaagatgcagtaaatgaggccaaacac
ctgggcatcaaggtcttttctgtggccatcacacctgaccacctggagccacgtctaagt
atcattgccacagaccacacataccggcgcaatttcacggcagctgactgggggcatagc
cgcgatgcagaagaggtcatcagccagaccattgacaccattgtggacatgattaaaaat
aacgtggaacaagtgtgttgttcttttgagtgccaggctgccagaggacctccagggccc
cgaggcgaccctgggtatgagggggagcgaggaaagccaggtcttccgggagagaaggga
gaagctggagaccctggacgacctggggatcttggaccagtcgggtaccagggtatgaag
ggagaaaaggggagccgtggagagaagggttccagaggaccgaaaggttacaagggcgag
aaaggcaagcgcggaatcgacggggtcgacggcatgaagggagagacggggtacccagga
ctaccgggctgcaagggctccccaggatttgatggcattcaaggacccccgggtcccaag
ggtgatgctggtgcctttgggatgaagggagaaaagggtgaagctggagcagacggtgag
gctgggagaccagggaactcagggtcacctggagatgagggtgatcctggagagcctggt
ccccccggagaaaaaggagaggccggtgatgaaggaaatgctggcccagacggtgcccct
ggagagaggggtggccctggtgaaagaggacctcgggggacccctggtgtgagaggacca
aggggagacccgggtgaagctggaccacagggtgaccaaggaagagaggggcccgtcggc
atccctggagactcgggtgaggctggccccattggacctaaaggataccgaggtgatgag
ggtcctccaggtcctgagggcctcagaggagccccaggacctgttggtcctcctggagac
cccggactgatgggtgagagaggtgaggatggaccaccaggaaacggcacggaaggtttc
cccggcttccctgggtatccaggcaacagaggccctcctgggctaaatggcacaaaaggc
taccctggcctcaagggggatgagggtgaagtgggagacccaggagaggataacaacgac
atttcaccccgtggggtcaaaggggcaaagggataccgaggcccagaaggaccccaggga
cctccaggacatgtgggaccacctgggccagatgagtgtgagatcctggatatcatcatg
aaaatgtgctcctgctgtgagtgcacatgtggacccattgacatcctcttcgtgctggac
agctcggagagcattggcctacagaactttgagattgccaaggacttcatcatcaaggtc
attgaccggttgagcaaggatgagctggtcaaatttgagccagggcagtctcacgcgggc
gtggtacagtacagccacaaccagatgcaagagcacgtggacatgcggagccccaacgtc
cgcaacgcccaggacttcaaagaagctgtcaagaagctacaatggatggctggtggcaca
ttcaccggagaagcgctgcagtacacccgggaccggctactcccacccacacagaacaac
cgaattgccctggtcattacggatggacgttctgacactcaacgggacacgacacctctc
agtgtgctctgtggtgcagacattcaggtagtttctgtgggaatcaaggatgtgtttggc
tttgtggcgggctccgaccagctcaatgtcatttcctgccaaggcttatcgcaaggtcgg
ccaggtatctccctggtgaaggagaactatgcagagcttctcgatgacggctttctgaag
aacataacagcccagatctgtatagataagaagtgtccggattatacctgtccaatcaca
ttctcctccccggctgacatcaccatcctgctagacagctcagccagtgtcggcagccac
aacttcgaaaccaccaaggtcttcgccaagcgcctagctgagcgattcctgtcagcaggc
agggcggatccttcccaggatgtgcgggtggccgtggtacagtatagtggccaggggcag
caacagccaggtcgggcggctcttcagttcttacagaattacacagtgctggccagctct
gtggacagcatggatttcatcaacgacgccacagacgtcaacgatgctctgagctacgtg
actcgtttctaccgggaagcctcgtcaggtgccaccaagaagagagtgctgttgttttca
gacggcaactctcagggggccacagcagaggccattgagaaggctgtgcaggaggcccag
cgtgcaggcattgagatctttgtggtggtggtgggaccccaggtgaacgagccccacatc
cgtgtgcttgtcactggcaagactgcagagtacgacgtggcctttggcgagcgccaccta
ttccgtgtaccaaactaccaggccctgctacgtggcgtactctaccagacagtctccagg
aaggtggcactgggctag

KEGG   Mus musculus (mouse): 12834
Entry
12834             CDS       T01002                                 

Gene name
Col6a2, Col6, Col6a-2
Definition
(RefSeq) collagen, type VI, alpha 2
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12834 (Col6a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12834 (Col6a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12834 (Col6a2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12834 (Col6a2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12834 (Col6a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12834 (Col6a2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12834 (Col6a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12834 (Col6a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12834 (Col6a2)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   12834 (Col6a2)
SSDB
Motif
Pfam: VWA Collagen VWA_2 VWA_3 Ins134_P3_kin_N
Other DBs
NCBI-GeneID: 12834
NCBI-ProteinID: NP_666119
MGI: 88460
Ensembl: ENSMUSG00000020241
Vega: OTTMUSG00000020488
UniProt: Q02788
Position
10 C1; 10 39.32 cM
AA seq 1034 aa
MTTIKMLQGPLSVLLIGGLLGVLHAQQQEAISPQEQEAVSPDISTTERNNNCPEKADCPV
NVYFVLDTSESVAMQSPTDSLLYHMQQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQV
EVFSPPGSDRASFTKSLQGIRSFRRGTFTDCALANMTQQIRQHVGKGVVNFAVVITDGHV
TGSPCGGIKMQAERAREEGIRLFAVAPNRNLNEQGLRDIANSPHELYRNNYATMRPDSTE
IDQDTINRIIKVMKHEAYGECYKVSCLEIPGPHGPKGYRGQKGAKGNMGEPGEPGQKGRQ
GDPGIEGPIGFPGPKGVPGFKGEKGEFGSDGRKGAPGLAGKNGTDGQKGKLGRIGPPGCK
GDPGSRGPDGYPGEAGSPGERGDQGAKGDSGRPGRRGPPGDPGDKGSKGYQGNNGAPGSP
GVKGGKGGPGPRGPKGEPGRRGDPGTKGGPGSDGPKGEKGDPGPEGPRGLAGEVGSKGAK
GDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGTPG
EKGEPGPPGPEGGRGDFGLKGTPGRKGDKGEPADPGPPGEPGPRGPRGIPGPEGEPGPPG
DPGLTECDVMTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRL
GAIAKDPKSETGTRVGVVQYSHEGTFEAIRLDDERVNSLSSFKEAVKNLEWIAGGTWTPS
ALKFAYNQLIKESRRQKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHE
THESENLYSIACDKPQQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPELPCQTELYVA
QCTQRPVDIVFLLDGSERLGEQNFHKVRRFVEDVSRRLTLARRDDDPLNARMALLQYGSQ
NQQQVAFPLTYNVTTIHEALERATYLNSFSHVGTGIVHAINNVVRGARGGARRHAELSFV
FLTDGVTGNDSLEESVHSMRKQNVVPTVVAVGGDVDMDVLTKISLGDRAAIFREKDFDSL
AQPSFFDRFIRWIC
NT seq 3105 nt   +upstreamnt  +downstreamnt
atgactactatcaagatgctccagggtcctctttctgtgctcctgattgggggactcttg
ggggtcctccatgcccagcagcaggaagccatctcaccccaggagcaggaagctgtctca
ccagacatctccaccactgaaaggaacaacaattgtccagagaaggccgactgcccagtc
aacgtgtatttcgtgttggacacctcagagagcgtggccatgcagtccccgacagacagc
ctgctctatcatatgcagcagttcgtaccgcagtttatcagccagctgcagaacgagttc
tacctggaccaggtggccctgagctggcgctacggtggtctacacttctcggaccaagtg
gaggtgttcagcccaccgggcagtgaccgggcctccttcactaagagcctacaaggcatc
cgctccttccgcaggggcaccttcactgactgtgcattggctaacatgacgcagcagatc
cggcagcacgtaggcaagggggtggtcaacttcgccgtggtcatcactgacggccacgtc
acgggcagtccgtgtgggggcatcaagatgcaggctgagcgtgcccgtgaagagggcatc
cggctcttcgctgtggcccctaacaggaacctaaacgaacaaggcctgagggacatcgct
aactctccacatgagctctaccgtaacaactacgccaccatgcgacccgactctaccgag
attgaccaggacaccatcaaccgcatcatcaaggtcatgaaacatgaagcctatggagag
tgctacaaggtgagctgcctggagattcctggaccccacggacccaagggttaccgagga
cagaagggtgccaagggcaacatgggtgaaccaggagagcctggacagaaaggacgacag
ggagaccccggcatcgaaggccccattggattcccgggaccgaagggtgtgcctggcttc
aagggagagaagggtgaatttggatcggatggtcggaagggagcgcctggcctagctggc
aagaatggaacagatggacagaagggcaaactgggccgcattgggcctcctggttgcaag
ggagaccccggaagtcggggccccgatggataccctggagaagctggaagcccaggcgag
cgaggagaccagggtgccaagggggactctggccgcccaggacgcaggggaccaccagga
gatcctggagacaaaggaagcaagggatatcaaggcaacaacggagcccctggaagcccg
ggagtgaaaggaggcaagggagggcctggcccccgtggaccaaaaggagagcctggacgc
agaggagaccccgggaccaagggcggccccggcagcgatggtccaaagggagagaaggga
gaccctggtcctgaggggcctcgaggcctggctggagaagttggcagtaaaggagccaag
ggagacagaggtttgcctggacccagaggcccccagggggctcttggagagccaggaaag
cagggatctcgaggagaccctggtgacgccggacctcgaggggattcaggacagccgggc
cccaagggcgatcctggaaggcctggattcagctacccgggacctcgagggacacccggt
gaaaaaggcgagcccggtccaccaggccctgagggaggccgaggagactttggtctgaaa
ggaacacccggacggaagggagataaaggggagccagctgatcctggtccccctggtgaa
cctggccctcgggggccaagaggaatcccaggacctgagggagaacccggccctccagga
gaccctggtctcacggaatgtgatgtcatgacctatgtgagggagacctgtggatgctgc
gactgtgagaagcgctgtggtgccctggatgtggtcttcgtcatcgacagttctgagagt
attggctacaccaacttcaccttggagaagaactttgtcatcaatgtggtcaacaggcta
ggtgccattgccaaggaccccaagtcagaaacaggcacacgtgtgggtgtggtgcagtac
agccacgagggcacctttgaggccatccggctggacgacgagcgagtcaactccctgtct
agtttcaaggaggctgtcaaaaaccttgaatggatcgccggtggcacttggacgccctct
gccctcaagtttgcctataatcagctcatcaaagaaagccggcgccagaagacccgggtg
ttcgcagtggtcatcacggatgggcgccatgacccccgagatgatgacctcaatcttcgg
gcactgtgtgaccgagatgtcactgtgacagccattggcatcggtgacatgttccacgag
actcatgagagtgagaacctctactccattgcctgtgacaagccacagcaagtgcgcaac
atgacgctgttctctgacctggtggccgagaagttcatcgatgacatggaagacgtcctt
tgtccagacccccagatcgtgtgtccagaacttccctgccaaacagagctctatgtggcc
cagtgcacacaacggcccgtggacattgtcttcctgctggatggctcggagcggctgggc
gagcagaacttccacaaggtgcggcgcttcgtggaggacgtgtcccggcgcctgactctg
gcccggagggatgatgacccactcaacgcccgcatggctctgttgcaatatggcagccag
aatcagcaacaggtggccttcccactgacctacaacgtgaccaccatccacgaggccctg
gagagggccacctacctcaattccttttctcacgtgggcacgggcatcgtacacgccatc
aacaacgtggtgcggggggcacggggtggggcgcggcgccacgcagagctctccttcgtc
ttcctcacggacggtgtcaccggcaatgacagcctggaggagtcagtgcactctatgcgt
aagcagaacgtggtgcccactgtggtcgctgtgggcggcgacgtggacatggatgtgctt
actaagatcagcctgggtgacagggcggccatcttccgggagaaagactttgacagtctg
gcccagcccagcttctttgacaggttcatccgctggatctgttag

KEGG   Mus musculus (mouse): 12835
Entry
12835             CDS       T01002                                 

Gene name
Col6a3, AI507288, Col6, Col6a-3
Definition
(RefSeq) collagen, type VI, alpha 3
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12835 (Col6a3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12835 (Col6a3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12835 (Col6a3)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12835 (Col6a3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12835 (Col6a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12835 (Col6a3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12835 (Col6a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12835 (Col6a3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12835 (Col6a3)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   12835 (Col6a3)
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 Kunitz_BPTI fn3
Other DBs
NCBI-GeneID: 12835
NCBI-ProteinID: NP_001229937
MGI: 88461
Ensembl: ENSMUSG00000048126
Vega: OTTMUSG00000022359
UniProt: Q9Z0I9
Structure
PDB: 
4IHK 4IGI

Position
1 D; 1 45.53 cM
AA seq 3284 aa
MRKHRHLPLVAVFSLLLSGIATTHAQQHGDVKNGAAADIVFLVDSSWSAGKDRFLLVQEF
LSDVVESLAVGDNDFHFALVRLNGNPHTEFLLNTYHSKQEVLSHIVNMSYIGGSNQTGKG
LEYVIHSHLTEASGSRAADGVPQVIIVLTDGQSEDGFALPSAELKSADVNVFAVGVEGAD
ERALGEVASEPLSMHVFNLENVTSLHGLVGNLVSCIHSSVNPERAGDKESLKDITAQDSA
DIIFLIDGSQNTGNANFDVIRDFLVNVLERLSVGNQQVQVGVVQYSEEPITMFSLNSYPS
KAAVLDAVKGLSLVGGESANIGQALDFVVENHFTRAGGSRVEEGVPQVLVLISAGPSSDE
IRDSVVALKQASVFSFGLGAQAASRAELQHIATDDSLVFTVPEFRSFGDLQEQILPYLVG
VAQRHIVLQPPAIVTQVMEVNKRDIVFLVDGSSSLGPSNFNAIRDFVTRVIQRLEIGQDL
VQVSVAQYADTVKPEFYLNSYTNKRDAITAVRKMRALNGSALYTGSSLDFVRNNLFTSSA
GHRAAEGVPKLLVLITGGKSLDEVSQPAQELKRGSIMALAVGSKAADEDELKEIAFDSSL
VFIPAEFRPAPLQNMLPSLMAPLRTLTGTTEVHVNKRDIIFLLDGSDNVGKNNFPYVRDF
VTNLVNSLDVGSDNIRVGLVQFSDTPVTEFSLDTYQTKSELLAHLRRLQLKGGSGLNAGS
ALSYIHANHFTEAGGSRTREHVPQLLLLLMAGPSEDAYLQAANALVRSGVLTFCVGTNRA
DKAELEHIAFNPSLVYLMDDFRSLPSLPQQLIQPLTTYVSGGVQEVPLSQPESKRDILFL
FDGSVNVLGQFPAVRDFLYRIIEELDVKPDGTRVAIAQFSDDVRLESRFSEHQTKAEILN
LVKKMKLKTGKALNLGYALDYALRNIFVRSAGSRIEDNVQQFLVLLVAGRSSDAVAGPAS
SLKQRGVVPFIFQAKNANPSELEQIVLSPAFILAAESLPKIGDLQSQIVSLLKAEQGSGP
VSGEKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDRVRVALVQYSDRTRPEFYLN
SHMDQQGVISAIRRLTLLGGPTPNTGAALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEP
SGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDFAVAIPTFRELGTIQQVISE
RVIQLNREELSSLKPILTPSTGAGVGSKKDVVFLIDGSRNAGPEFQYIRTLIERIVEYLD
IGFDTTRVAVIQFSEDSKMEFPLNAHFSKDEVQNAVRRLRPKGGSQVYIGNALEYVLKNI
FQRPLGSRIEEGVPQFLVLISSGKSDDEVDDSAVELKQFGVAPLTIARHTDQEELVKISL
SPEYVYSVSTFRELPRLEQKLLTPITTLTSQQIHQILASTRYPPSVVESDAADIVFLIDS
SDAVKPDGIAHIRDFVSRIVRRLNIGPSKVRIGVVQFSNDVFPEFYLKTHKSQSSVLEAI
RRLRFKGGSPLNTGRALEFVARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDVARHAQVI
SSSGIVSLGIGDRNIDRTDLQTITNDPRLVFTVREFRELPNIEERVMLSFGPSGATPQPP
GVDLPSPSRPEKKKADIVFLLDGSINFRRDSFQEVLRFASEIVDTVYEDGDSIRVGLVQY
NSDPTDEFFLRDFSTKRQIIDAINKVVYKGGRHANTRVGIEHLLRNHFVPEAGSRLDERV
PQIAFVITGGKSVEDAQDVSLALTQKGVKVFAVGVRNIDSEEVGKIASNSATAFRVGSVQ
ELSELSETVLETLHDAMHETLCPGVTDVSKACNLEVILGFDGSRDQNVFVSQKGLESKVD
IILNRISQIQRISCSGNQLPTVRVSVMANTPSGPVEAFDFAEYQPELFEKFRNMRSQRPY
VLTADTLKLYQNKFRQSSPDTVKVVIHFTDGADGDMADLYRASEELRQAGAQALILVGLE
RVANLERLMHLEFGRGFMYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGERGDR
GPIGSIGPKGISGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEK
GELGEIGLDGLDGEEGDKGLPGSSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGDSGRD
SQQRGPKGETGDIGPMGLPGRDGIPGSPGDPGKDGGSGRRGPAGAKGNRGGPGQPGFEGE
QGTRGSQGPPGPIGPPGLIGEQGIPGPRGGGGTAGAPGERGRTGPLGRKGEPGEPGPKGS
IGNRGPRGETGDDGRDGVGSEGRRGKKGERGFPGYPGPKGTPGEPGADGPPGPKGIRGRR
GNSGPPGATGQKGDPGYPGPSGHKGNRGDSVDQCALIQSIRDKCPCCYGPLECPVFPTEL
AFALDTSEGVTQDTFSRMREVLLGIVGDLTIAESNCPRGARVAVVTYNNEVTTEIRFADS
KKKSALLDSIQNLQVALTSKQQSLETAMSFVARNTFKRVRSGFLMRKVAVFFSNKPTRAS
PQLREAVLKLSDAGITPLFLTSQEDRQLINALQINNTAVGHALVLPARRDLTDFLKNVLT
CHVCLDICNIDPSCGFGSWRPSFRDRRAAGSDVDIDLAFILDSSEATTLFQFNEMKKYIG
YVIRQLDLSPDPKASQHFARVAVVQQSTYESVDNASVPPVKVEFSLTDYGAKEKLLDFLS
RRMTQLQGTMGLGNAIEYTIENIFESAPNPRDLKIMVLMLTGDMQRQQLEEAQRAILQAK
CKGYFFVVLGIGRKVNIKEVYSFASEPNDVFFKFVDKSTELNEEPLMRFGRLLPSFVSSE
NAFYLPPDLRKQCDWFQGDQPVKNGVKFGHKQINPPHTANSSLTSKVVTTMKPVTTTKPT
AIVNLPPAKPAPARPAPAQPVLAKPDPAKPAQARPAPAKPASAKLVPPQPVHVQPAPAQT
ASVRPAPAKPAPPQPAAAKPVPAKPAVPAQPAPPQPAAAKPVPAKPAVPAQPAPPQPAAA
KPVPAKPAVPAQPAAAQPMPAQPVLTKSAAVKPASANKPVAAKPVATNTATATARPALAA
KPAAAKPAATRPLAAAIRPVATKPEAPRQQAKPAATKPATTKPLARVSREVQVSEVTENS
ARLHWERPEPSSSFFYDLTVTSAHDQSLVLRQNLTVTDRVIGGLLAGQLYHVVVVSYLQS
QVRAIYQGSFNTKKTQPPPLQAAHRASSSTINLMVNTEPLFLTKTDICKLSRDAGTCVDF
KLLWHYDLESKSCKRFWYGGCGGNENRFHSQEECEKMCSPELTV
NT seq 9855 nt   +upstreamnt  +downstreamnt
atgaggaaacaccggcatctgcccctagtggctgtctttagccttctcctctcaggcatt
gccacgactcatgcccaacagcatggagatgtcaaaaacggtgcggcggctgacatagtg
tttctagtggattcctcttggagtgctgggaaggaccgtttcctgcttgttcaagagttt
ctgtctgatgttgtagagtctttagctgtgggagacaatgattttcactttgctctggtc
cggctcaacggaaacccacataccgagttcctgttaaatacataccactctaaacaagaa
gtcctttctcatattgtgaacatgtcttacattgggggaagcaaccaaactggaaaagga
ttagaatacgtaattcacagccacctcactgaggcttccggaagccgggctgctgacgga
gtccctcaggttatcatagtattaactgatggacaatcggaggatggcttcgctctgccc
tcagcggaacttaagtctgcggacgttaatgtgtttgcagtcggagttgagggtgcagat
gaaagagccctaggagaagtagcaagcgaaccactcagtatgcatgttttcaacctagag
aacgttacctcactgcatggcctagtagggaacttagtgtcctgtatacactcctctgtg
aatccagaaagggctggggacaaggaaagccttaaagacatcacagcacaagactcagct
gacattattttccttattgatggatcacagaacaccggaaatgccaatttcgatgtcatt
cgagacttccttgtaaatgtccttgagagactctcagttggaaaccagcaggtccaagtg
ggggtggtacagtatagcgaggagcccataaccatgttctccttgaatagctacccctcc
aaggctgcagttctggatgccgtgaaagggctcagcttggttgggggggagtcggccaat
ataggccaggctcttgactttgtagtggagaatcacttcactcgggcaggtggcagccgc
gtggaggaaggggtcccccaggtgctggtcctcataagtgctgggccttctagtgatgag
attcgagattcggtggtagctctgaagcaggctagtgtgttctcgtttggcctcggagcc
caggcagcctccagggcagagcttcagcacatagctaccgatgacagcttggtgtttact
gtcccggaattccgtagctttggggatctccaggagcaaatactgccgtaccttgttggt
gtggcccaaaggcacattgtcttgcaaccaccagctattgtcacacaagtcatggaagtc
aacaagagggacatagtcttcctggtggatggttcctccagcctggggccatccaacttc
aatgccatccgagacttcgttaccagagtcatccagaggttggaaattggacaggacctg
gttcaggtatcagtggctcagtatgcagacactgtcaagcctgagttctatttaaattcc
tataccaacaaaagggatgccataactgctgtacggaagatgagggccctgaatggctca
gccctgtacacgggatcttctctggactttgttcgaaacaacctcttcactagctcagcc
ggccatagggccgctgagggggttcctaagctcctggtgctgatcacaggcggtaagtcc
ctcgatgaagtcagccagcctgcccaggagctgaagagaggcagcatcatggccttggcc
gttggcagcaaggccgccgatgaggatgagctgaaagagatcgctttcgactcctccctg
gtcttcattcccgctgagttccgccctgctcccttgcaaaacatgctgcccagcctgatg
gcacctctcaggactctcactggaaccacggaagttcacgtaaacaaacgggatatcatc
ttccttttggatggctccgacaacgttgggaaaaacaatttcccttatgtgcgtgacttt
gtaaccaacctagttaacagcctcgatgttggaagtgacaatatccgtgttggcttggtg
cagtttagtgacactccggtcacggagttctctctagacacttaccagaccaagtccgag
ctgctcgctcacctgaggcgcttgcagctcaaggggggctccggcttgaacgcaggctct
gccttgagctatatccatgccaatcacttcacggaggcaggaggcagcaggactcgtgaa
cacgtgcctcagctgctgctcctgctcatggccgggccctctgaggatgcctatttgcaa
gctgccaatgccctggtgcgctcaggcgtgctgaccttctgtgtggggaccaatcgggcg
gataaggctgagttagagcatattgcttttaatcccagcctggtatacctcatggacgat
ttccgctccctgccatctttgcctcaacagctgattcagcccctaaccacatatgttagt
ggaggtgtacaggaagttccactatcccagccagagagcaagcgggacattcttttcctc
tttgacggctcagtcaatgtcttgggtcagttccctgctgtcagagactttctctacagg
atcattgaggaacttgatgtgaagccggatgggacccgggtagcaatagctcagttcagt
gatgacgtcaggctggagtcccgcttcagtgagcaccagacgaaagctgaaatccttaat
ctcgtgaagaagatgaagctaaaaacaggcaaagccctcaacctgggctacgccctggac
tacgcgcttaggaacatctttgtgaggtcggctggcagccgcatcgaggataacgtgcag
cagttcctggtgctgctggttgctggaaggtcgtcagatgctgtggccgggcctgcaagc
tccctgaagcagagaggagtggtacctttcatctttcaagccaagaacgccaaccccagt
gagctggagcagattgtgctgtcgcctgcattcatcctggctgcagagtcactccctaag
atcggagacctccaatcacagattgtgagccttctgaaagcagaacagggttcaggccct
gtatcaggtgaaaaggatgtggtgtttctcattgatggctctgagggtgtccgcagtggc
ttccccctgctaaaggactttgtgcagagggttgtggagagcttggatgtgggtcccgac
cgtgtgcgtgtggcactggtgcagtacagtgaccggaccaggccggagttctacctgaat
tcccacatggaccagcagggtgtcatcagcgccatccgcaggctgacactgctgggcggc
ccaacccccaacacaggggcggcactggagttcgtgttaaggaacattctgaccagttct
actgggagcaggatagcagaaggtgttcctcagctcctgattgtcctcacagcagagcca
tcaggggatgacgtgcgaggcccttcagtagtcctgaagcagggcggggctgtgcccatt
ggcattggcattgggaatgctgacatctctgaaatgcagaccatctccttcatccctgac
tttgctgtggccatccccaccttccgggagcttgggacgatacagcaggtcatctctgag
agggtgatccagcttaatcgtgaggagctgagctcgttgaaacccattttgacgccctca
acaggtgcaggtgttggcagcaagaaagatgtggtctttctcatcgatggatcccgaaat
gctggccctgagttccagtacatccgtaccctgattgagaggatagtcgagtacctggac
ataggctttgacaccacccgggtagccgtcatccagttcagtgaggactccaagatggag
tttcctctgaatgcccacttcagcaaggatgaagtacagaacgctgtgcgcaggctgcgg
cccaagggtgggagtcaggtctacatcggaaatgccctggagtacgtgctgaagaacatc
ttccagaggccactggggagccggatagaagagggcgttccgcagttcctagtcctcatt
tcgtctggaaagtctgatgatgaggtggacgactcagccgtggaactcaagcagttcggt
gtggcccctctcaccatagccagacacacagaccaagaggagctggtgaagatctcccta
agtcctgagtacgtgtactccgtgagcaccttcagggagctgcccagactggagcagaag
ctgctgacgcccatcaccactctaacctcacagcagatccatcagatcctggccagtacc
cgatatcccccttcagtggttgaaagcgatgcggctgacatcgtctttctgattgacagc
tctgatgccgtcaagcccgatggcatcgctcatatccgagactttgtcagcaggatcgtt
cgcagactcaacattggtcccagtaaagtgaggattggggtcgtgcagtttagcaatgat
gtcttccctgagttctacctgaagacccacaagtcccagagcagtgtgcttgaagccata
cggcgtctgaggttcaaaggagggtctcccctaaacactggcagagccctggagtttgtg
gcaagaaacctcttcgtgaagtctgctgggagccggatagaagatggggtccctcaacac
ctggtcttattcctgggtgggaagtctcaggacgatgtggccaggcatgcccaagtcata
agctcatcggggattgtgagcttaggaataggagatcggaacattgataggacggacttg
caaaccatcaccaatgaccccaggctggtcttcacagttcgggaattcagagagctgccc
aacatagaagagagggtcatgctttcctttggaccctctggggctactcctcagcctcct
ggggtagatttaccttctccttcccggccagagaagaagaaggccgacattgtgttcctg
ctggatggttccatcaattttaggagggacagtttccaggaagtgctccgttttgcatct
gaaatcgtggacacggtctatgaagacggagattccatcagagtgggactggtccagtac
aactcagaccccacggatgaattcttcctgagggacttttctaccaaaaggcagattatc
gatgccatcaacaaagtcgtctataaaggagggaggcatgccaacaccagggtgggcatc
gagcacctgctgcggaatcactttgtgccggaggctggtagccgcctggatgagcgggtt
cctcagatcgccttcgtgatcaccggagggaagtcagtggaggatgctcaggatgtgagc
ctggctctcacccagaaaggtgtcaaggtgtttgccgttggcgtgaggaacatcgactct
gaggaggtgggcaagatagcctccaacagtgccacagccttccgggtgggcagcgtgcag
gaactgtccgaactgagtgagacagtgctcgagactctgcatgatgcaatgcatgagacc
ctctgccctggtgtgaccgatgtctccaaagcctgcaatctggaagtcattctggggttt
gatggatctcgagatcagaatgtgtttgtgagtcagaagggccttgagtccaaggtggac
atcatcttgaacagaatcagccagatacaaaggatcagctgcagtggcaaccagctgccc
actgtgagggtatccgtgatggcgaacacgccctctgggccagtggaggcctttgacttt
gccgagtatcagccggagctgtttgagaagtttcgcaacatgcgcagtcagcgcccatac
gtcctcacagctgacacgctgaagttgtaccagaacaagttcaggcagtcgtcgcctgat
actgtgaaggtagtcattcacttcacggatggagcagatggagacatggctgacttatac
agagcatctgaggaactccggcaagcaggtgcccaagccctgatcctggtgggtcttgaa
cgtgtggctaacctggagcggctgatgcatctggagttcgggcggggcttcatgtatgac
aggcccctgaggctcaacctgcttgacttagactatgaactggcagagcagcttgacaat
attgctgagaaagcttgctgtggggttccatgcaagtgctctggagagaggggagacaga
gggcccattggcagcattgggccaaagggtatctccggggaagatggctaccgaggctac
ccgggagacgaaggcggacctggtgagcgaggtccacctggtgtgaatggcacacaaggt
ttccagggctgtccaggccagaggggagtgaagggttctcgaggattcccaggagagaag
ggtgaattgggagaaatcggcttggatggtctggatggtgaagagggagacaaggggctg
cctggttcttctggagaaaaggggagtcctggaagaaggggtgacaaaggacccaaagga
gacaaaggcgagagaggagatgtcgggattcgaggtgacccgggtgactcaggacgggac
agccagcagagaggacccaaaggagagacgggagacatcggccccatgggtctcccaggc
agagatggcatccctggcagcccaggagaccctgggaaggacggtggctctggccgaagg
ggccctgcaggagctaagggcaacagaggtggtcctggccagccaggcttcgaaggcgag
cagggtaccagaggctcacagggcccacctggtcccattggtcccccaggcctgattggg
gaacaaggaattcccggacctcgaggaggcggaggtacggctggggctcctggagaacgt
ggcagaactggtcctctggggaggaagggtgagccaggagagccagggccgaagggaagc
atcgggaaccgtggaccccgaggagagacgggagatgacgggagagatggggttggcagt
gaaggacgcagaggcaaaaaaggagaaagaggcttccctgggtatccgggaccaaagggc
acccctggtgagccaggggcagatggaccaccaggacccaaaggcatcagaggtcgaagg
ggaaattcaggacctccaggggcaactggacaaaagggagaccctggttacccaggacca
tctggtcacaagggcaaccgaggcgactccgttgatcaatgcgccctcatccagagcatc
agagacaaatgcccttgctgctacgggcccctggagtgccctgtattcccaacagaactc
gcctttgccctggatacctctgagggggtgactcaggacaccttcagccggatgcgagag
gtgcttctgggcattgtgggcgatctgaccattgcagagagcaactgtccgcggggtgcc
cgcgtggctgtggtcacctataacaatgaggtgactacagagatccggtttgctgactcc
aagaagaagtctgccctcttagacagtattcagaacctccaagtggccttgacctctaag
cagcagagcctggagaccgcaatgtcattcgtggccaggaatacattcaaacgtgtgagg
agtggcttcctgatgaggaaagtggctgttttcttcagcaacaagcccaccagggcatcc
ccccagctccgagaggccgtactcaagctttccgatgcggggatcacacccttgttcctt
acaagccaggaggaccgacagctcatcaacgctttgcagatcaataacacagcagtggga
catgccctggttctgcctgcaaggagggatctcacagacttcctgaagaatgtccttacc
tgccatgtttgcttggacatttgcaatatcgacccatcctgtggcttcggcagctggagg
ccttccttcagggaccggagggcagcaggcagtgatgtggacatagacctggctttcatc
ttggacagctcagaggctaccacactgttccagttcaatgagatgaagaaatacataggc
tatgtgatcagacagctggacctgagcccagacccgaaggcttcccaacactttgccagg
gtggctgttgtgcagcagtcaacctacgagtctgtggacaatgccagtgtgccgcctgtg
aaggtggaattctcactgacagactatggtgccaaggaaaagctgttggatttccttagc
cggaggatgacccaacttcagggaaccatgggcctgggcaatgccattgaatacactata
gagaacatctttgaaagtgctccaaacccacgggacctcaaaattatggtgctgatgttg
actggtgacatgcagaggcagcagctggaggaggcccagagagccatcctccaggccaag
tgcaagggttacttctttgtggttctgggcattggcaggaaggtgaatatcaaggaggtc
tacagctttgccagtgagcccaatgatgtcttcttcaaatttgtggacaaatcaactgag
ctcaacgaggagcctctgatgcgctttgggaggctgctcccatcctttgtcagcagtgaa
aatgcattttacctgcctccagatctcaggaaacagtgtgattggttccaaggggaccaa
ccagtgaagaatggcgtgaagtttggtcacaaacagataaaccctccacatactgctaat
tcaagtcttacatccaaagttgtgaccacaatgaagccagtgacaacgaccaaaccaaca
gcaattgtaaacctgccacctgctaagccagccccagcgaggccagcccctgctcagcca
gttcttgctaagccagaccccgcaaaaccagcccaagcaaggccagcccctgctaagcca
gcttctgctaagttggtgcctcctcagccagtccatgttcagccagcccctgcccagaca
gcttctgtaagaccagcccccgctaagccagcccctcctcagccagctgctgctaagcca
gtccctgctaagccagcagtccctgctcagccagcccctcctcagccagctgctgctaag
ccagtccctgctaagccagcagtccctgctcagccagcccctcctcagccagctgctgct
aagccagtccctgctaagccagcagtccctgctcagccagccgctgctcaaccaatgcct
gctcagccagtccttactaaatcagccgctgtgaaaccagcctctgccaacaagcctgtg
gcagccaaacctgtggccacgaacacagccacagccacagccagacctgcattagcagcg
aagcctgctgcagcgaagcctgcagcaacgagaccccttgctgctgccataaggccagtt
gctaccaagccagaggcccccaggcaacaggccaaaccagctgccaccaagccagccact
actaagcccttggcgagagtgtcccgagaagtccaggtctctgaagtcacggagaacagt
gccagactccactgggagcggcccgagccttccagctcctttttttatgacctcactgta
acctcggcccacgaccagtccttggttctgagacaaaacctcactgtcactgaccgtgtc
atcggaggcctactggctggacagctgtaccatgtcgtagtggtctcctacctgcagtct
caggtcagggccatctaccaaggaagtttcaatacgaagaaaacccagcctccacctctt
caggcagcacaccgagcatccagttcaaccatcaacctcatggtgaacacagaaccattg
tttctcactaaaacagatatatgtaagctgtccagagatgctgggacttgtgtggacttc
aagttactatggcactatgacctagagagcaaaagttgcaagagattctggtatggaggt
tgtggaggcaacgagaacagattccactcccaggaagaatgtgaaaagatgtgtagtcct
gagttaacagtttga

KEGG   Mus musculus (mouse): 12839
Entry
12839             CDS       T01002                                 

Gene name
Col9a1, Col9, Col9a-1
Definition
(RefSeq) collagen, type IX, alpha 1
  KO
K08131  collagen type IX alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12839 (Col9a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12839 (Col9a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12839 (Col9a1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12839 (Col9a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12839 (Col9a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12839 (Col9a1)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   12839 (Col9a1)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 12839
NCBI-ProteinID: NP_031766
MGI: 88465
Ensembl: ENSMUSG00000026147
Vega: OTTMUSG00000022796
UniProt: Q05722 G3X995 Q8BSQ4 Q9CT83 Q8CEP0
Position
1 A5; 1 9.95 cM
AA seq 921 aa
MKNFWKISVFFCVCSCLGPWVSATLKRRARFPANSISNGGSELCPKIRIGQDDLPGFDLI
SQFQIEKAASRRTIQRVVGSTALQVAYKLGSNVDFRIPTRHLYPSGLPEEYSFLTTFRMT
GSTLEKHWNIWQIQDSAGREQVGVKINGQTKSVAFSYKGLDGSLQTAAFLNLPSLFDSRW
HKLMIGVERTSATLFIDCIRIESLPIKPRGQIDADGFAVLGKLVDNPQVSVPFELQWMLI
HCDPLRPRRETCHELPIRITTSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
PGPPGPPGDPGKPGAPGKPGTPGADGLTGPDGSPGSVGPRGQKGEPGVPGSRGFPGRGIP
GPPGPPGTTGLPGELGRVGPIGDPGKRGPPGPPGPPGPSGTIGFHDGDPLCPNSCPPGRS
GYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGDQGPPGPQGLRGITGIVGDK
GEKGARGFDGEPGPQGIPGAAGDQGQRGPPGETGPEGDRGIQGSRGIPGSPGPKGDTGLP
GVDGRDGIPGMPGTKGEAGKPGPPGDVGLQGLPGVPGIPGAKGVAGEKGNTGAPGKPGQL
GSSGKPGQQGPPGEVGPRGPRGLPGSRGPVGPEGSPGIPGKLGSVGSPGLPGLPGPPGLP
GMKGDRGVFGEPGPKGEQGASGEEGEAGARGDLGDMGQPGPKGSVGNPGEPGLRGPEGIR
GLPGVEGPRGPPGPRGMQGDQGATGLPGIQGPPGRAPTDQHIKQVCMRVVQEHFAEMAAS
LKRPDTGASGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEK
GERGPPGRGPKGLPGAIGLPGDPGPASYGKNGRDGEQGPPGVAGIPGVPGPPGPPGPPGF
CEPASCTLQSGQRAFSKGPDK
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgaagaacttctggaaaatctcagttttcttctgtgtgtgcagttgtctgggaccctgg
gtatccgcaactcttaagcgtcgtgcaagatttcctgccaattccatttctaatggtgga
agtgaactgtgtcccaagatcaggattggccaagatgacttaccagggtttgacctgatt
tctcagttccaaattgagaaggctgcatctcgaaggactatccagagggtggtgggatcc
acagccttacaagtggcttacaagctgggaagtaatgtagacttcaggattccaacaagg
catttgtatcccagtggactgcctgaagaatattcctttttaactactttccggatgact
ggaagcacacttgaaaagcactggaacatttggcagatccaggattccgcagggagagag
caagttggcgtgaagataaatggccaaacaaagtctgtcgcattttcatacaagggactg
gatgggagtctccaaacggctgccttcttgaatttgccgtccttgtttgactcccggtgg
cataagctcatgattggcgtggaaagaacaagcgccactctttttattgactgcatcagg
atcgaatctttacctataaagccaagaggccagattgatgcggatggctttgcagtgctg
ggaaaacttgtggacaatcctcaggtttctgttccttttgaactccagtggatgctgatt
cattgtgaccccctgagacccaggagagaaacctgtcatgagctgccaatcagaatcaca
accagccagaccactgatgagagaggtcctccgggtgagcaggggcctccagggcctcct
gggcctcctggagttccgggcatagatggcattgatggtgaccgaggtccaaagggtccc
ccaggacctccgggtcctcctggagacccaggcaagccaggagcaccaggcaagccaggc
acaccaggagctgatggattaacaggacctgatggatcccctggctctgttggaccaagg
ggacaaaaaggagaacctggtgtacctgggtctcgtggatttccaggccgtggtattcca
ggaccccctggtcctcctgggaccacaggacttcctggagaacttggccgagtaggccct
attggagaccctgggaaaagaggaccacctggccctcctggacctccaggacccagtgga
acaattggatttcatgatggagacccattgtgccccaattcctgcccaccaggtcgctct
ggatatccaggcctaccaggcatgaggggccataaaggggcgaaaggagaaatcggcgag
ccaggaagacaaggacacaagggtgaagagggtgaccagggggaactgggagaagttggc
gatcaaggacctccaggacctcagggtctgagaggcatcactggcatagttggagacaaa
ggagaaaagggtgctcggggatttgatggagagcctggacctcagggcattccaggtgca
gctggtgatcaaggacagcgaggccctccaggagaaacaggtcctgagggagacagaggc
attcaaggttcccgaggaattcctggatccccagggccaaaaggagacacgggcttgcca
ggtgtagatggccgagatggaataccaggaatgcccgggacaaagggtgaagcagggaag
cctggaccccccggggacgtgggattgcagggcttaccaggtgtccctggaatccctggt
gcaaaaggtgttgccggtgaaaagggtaacacgggtgctccaggaaagcccggtcagttg
ggaagttcagggaaaccaggccaacaagggcccccaggagaggttggacctcggggaccc
aggggccttccaggcagtagaggcccggtaggaccagaagggtctccaggcataccaggg
aaactgggatctgttggcagccctggccttcctggcttgcctgggccccctggacttcct
ggaatgaaaggagacaggggtgtatttggtgaaccgggtcccaagggtgaacagggtgcc
tctggtgaagaaggtgaagcaggagcaaggggtgaccttggagatatgggacaacctggc
ccaaagggatctgtgggtaaccccggggagccgggtctgagggggcctgaaggaatcaga
gggcttcctggagtggaaggaccaagaggaccacctggaccccggggcatgcagggagat
cagggtgccactgggctgcctggtatccagggccctccgggcagagcgccgaccgaccag
cacatcaagcaggtttgcatgagagtcgtgcaagagcattttgcggaaatggcagccagc
ctcaagagaccagacacaggagcctctggtcttcctgggaggcctggcccccctgggcct
ccgggcccccctggagagaatggtttccctggtcagatgggaatccgtggtctcccaggc
attaagggtccccctggtgctcttggcttaagaggacctaaaggagacttgggagaaaaa
ggagaacgtggtcctccaggaagaggtcctaagggtttgcctggagcgataggtctccca
ggtgacccaggccctgccagctatgggaaaaatggccgtgacggagagcaaggtcccccg
ggagtggcaggaattcctggtgtgcctggacccccaggtcctccaggccctcctgggttc
tgtgagccagcctcttgcaccctgcagtctggtcaaagagcatttagcaaagggccggac
aagtga

KEGG   Mus musculus (mouse): 12840
Entry
12840             CDS       T01002                                 

Gene name
Col9a2, AI427499, Col9, Col9a-2
Definition
(RefSeq) collagen, type IX, alpha 2
  KO
K08131  collagen type IX alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12840 (Col9a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12840 (Col9a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12840 (Col9a2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12840 (Col9a2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12840 (Col9a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12840 (Col9a2)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   12840 (Col9a2)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 12840
NCBI-ProteinID: NP_031767
MGI: 88466
Ensembl: ENSMUSG00000028626
Vega: OTTMUSG00000008902
UniProt: I7HJR1
Position
4 D2.2; 4 56.78 cM
AA seq 688 aa
MTAVPAPRSLFVLLQVLWLALAQIRGPPGEPGPPGPPGPPGVPGSDGIDGDKGPPGKVGP
PGSKGEPGKPGPDGPDGKPGIDGLMGAKGEPGPVGTPGVKGQPGLPGPPGLPGPGFAGPP
GPPGPVGLPGEIGTPGPKGDPGPEGPSGPPGPPGKPGRPGTIQGLEGSADFLCPTNCPAG
VKGPQGLQGVKGHPGKRGILGDPGRQGKPGPKGDVGASGEQGIPGPPGPQGIRGYPGMAG
PKGEMGPRGYKGMVGSIGAAGPPGEEGPRGPPGRAGEKGDVGSQGARGPQGITGPKGTTG
PPGIDGKDGTPGIPGMKGSAGQVGRPGSPGHQGLAGVPGQPGTKGGPGDKGEPGQQGLPG
VSGPPGKEGEPGPRGEIGPQGIMGQKGDQGERGPVGQPGPQGRQGPKGEQGPPGIPGPQG
LPGIKGDKGSPGKTGPRGGVGDPGVAGLPGEKGEKGQSGEPGLKGQQGVRGETGYPGPSG
DAGAPGVQGYPGLPGPRGLVGDRGVPGQPGRQGVVGRAASDQHIVDVVLKMIQEQLAEVA
VSAKREALGAAGMVGLPGPPGPPGYPGKQGPNGHPGPRGIPGIVGAVGQIGNTGPKGKRG
EKGDRGEMGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGRPGPVGLP
GFCEPAACLGASAYTSARLTEPGSIKGP
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgaccgccgtgcccgcgccccgcagcctgttcgttctcctccaggtgctgtggctcgcc
ctggctcagatcagaggtccaccaggggagccgggtcctccagggccaccagggccacca
ggagtgcctggttcagatggcatcgacggtgacaaggggcctccaggtaaagttggtcct
ccgggatccaaaggagagcctggcaaacctggcccagatggtccagatgggaaacctggc
attgatggtttaatgggagccaagggagagcctggtcccgtggggacccctggagtcaag
ggccagcctgggctcccagggccccctggcctgccgggccctggttttgctggacctccc
ggaccccctggacctgttggcctccctggtgagattggaaccccaggccccaagggggat
ccaggaccagagggaccatcagggcccccagggccccctgggaaaccaggccgaccagga
accatccagggcttggaagggagtgcggatttcttgtgtccaaccaactgtccagctggt
gtgaagggtcctcagggtttgcaaggagtgaagggtcatccaggcaaacgggggattctg
ggtgatcctggtcgccaggggaagccaggtcccaagggagatgtgggtgcctctggagag
caaggcatccctggaccaccgggcccccaaggcatcaggggctacccgggcatggcagga
cccaagggagagatgggtcctcgtggctataaaggcatggtgggctccatcggggctgct
gggccaccgggtgaagaaggcccaagagggccaccaggccgagccggtgagaagggggat
gtggggagccaaggtgccagaggaccccaggggataacaggcccaaagggaacaaccggt
ccaccaggcattgatggcaaggatgggaccccaggcattcctggcatgaagggcagtgca
ggacaagtgggacggccaggaagcccaggccaccagggcttagcgggtgtgccgggtcag
cctggaacaaaaggaggtcctggagacaagggtgaaccaggccagcagggcttgccggga
gtctctggtccccctgggaaagaaggggagccagggcctcgaggagaaattggtccacag
ggcatcatgggacagaagggtgaccagggcgagagggggccagtgggacagccaggccct
caaggacgacagggccccaaaggagagcagggccctccaggaattccaggaccccaaggc
ttgccaggcatcaaaggagataagggttccccagggaagaccgggccccgaggcggagtg
ggtgacccgggggtggccggcctcccgggagagaaaggagagaagggccaatcaggcgag
ccagggcttaagggacagcaaggagtccgtggagagaccggctaccccggccccagcgga
gatgccggtgccccaggagtgcagggctaccccgggcttcccgggccccgaggactggtg
ggagatcgaggcgtgccaggacaacccgggagacagggtgtggtgggccgagccgccagt
gaccagcacatcgtggatgtggtgctgaagatgattcaagagcaacttgctgaggtagct
gtgagtgccaagcgagaagccctgggtgcagcagggatggtgggccttccaggacctcct
gggccccctggatatccaggcaaacaggggcccaatgggcatcccggcccccgaggcatt
cctggcatcgtgggagcagtgggtcagattggcaacactggacccaagggaaagcgtgga
gagaagggggatcgaggagaaatgggtcgtggccatcccgggatgcctgggcccccaggg
atcccaggtcttcctggccggcctggccaggcaatcaatggcaaggatggggaccgagga
tccccaggggctccaggagaggctgggagacctggccggccaggcccagtggggctacca
ggtttctgtgagcctgccgcatgcctgggggcttcagcctatacctctgctcgcctcaca
gagcctgggtccatcaaggggccatga

KEGG   Mus musculus (mouse): 12841
Entry
12841             CDS       T01002                                 

Gene name
Col9a3, AV006866
Definition
(RefSeq) collagen, type IX, alpha 3
  KO
K08131  collagen type IX alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12841 (Col9a3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12841 (Col9a3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12841 (Col9a3)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12841 (Col9a3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12841 (Col9a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12841 (Col9a3)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   12841 (Col9a3)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 12841
NCBI-ProteinID: NP_001365706
MGI: 894686
Ensembl: ENSMUSG00000027570
Vega: OTTMUSG00000016344
Position
2 H4; 2 103.14 cM
AA seq 719 aa
MTGAPALALLLLGQLLTATSAQKVGPRGPPGPQGPPGKPGKDGIDGEAGPPGLPGLPGPK
GTSGKPGKPGEAGLPGLPGVDGLTGRDGPAGPKGAPGERGSLGPPGPPGLGGKGLPGPPG
EAGVSGLPGGIGLRGPPGPSGLPGLPGLPGPPGPPGNPGVLPEGATDLQCPAICPPGPPG
PPGMPGFKGPTGYKGEQGEVGKDGEKGSPGPPGPPGIPGTVGLQGPRGLRGLPGPLGPPG
DRGPIGFRGPPGTPGAPGKVGDRGERGPEGFRGPKGDLGRPGPKGIPGMAGPGGEPGMPG
KDGKDGVPGLDGEKGEAGRNGGQGEKGPNGLPGLPGRAGSKGEKGEPGRTGELGEAGPSG
EPGIPGDVGVPGERGEAGHRGSVGALGPQGPPGAPGIRGFQGQKGSTGDPGLPGPQGLRG
DVGDRVRVVLLHLPALTSLHRLKPAAAHSFPRGWQGWQHQLCGQGPGGATGPKGDQGIAG
SDGLPGDKGELGPNGPVGQKGESGSRGELGPKGIQGPNGTSGVQGVPGPPGPLGLQGVQG
VPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRPGPAGPPGPP
GPPGSIGHPGARGPPGYRGPTGELGDPGPRGSQGDRGDKGATGAGLDGPAGDQGYQGPQG
VPGISKDGRDGAHGEPGLPGDPGLPGAAGAQGTPGICDTSACQGAVLGGGGEKSGPRSS
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaccggagcgcctgccctagccctgctgctgctggggcagctcctgacggccacctcc
gcgcagaaagtgggaccccgaggcccccctggtccccaagggcctcctggaaaacccggc
aaggatggcattgatggagaagctggccctccaggtctgcctggccttccaggacccaaa
gggacctcagggaagccagggaagccgggagaggcaggactgccaggactgcctggtgta
gatggtctgacagggagagatggacccgcaggacccaaaggtgcccctggagaacgggga
agtctaggacccccagggccaccaggacttgggggcaaaggcctccctggacctcctgga
gaggcaggagtgagtggcctcccaggtgggattggtctacgtggccccccgggaccctct
ggacttccaggactgcctggcctcccaggacctcctggacctcctggaaaccctggagtc
ctccctgaaggtgctactgatctgcagtgtcccgccatctgcccgccaggccctccggga
cccccaggaatgccggggttcaaggggcctactggctacaaaggggaacaaggagaagtt
ggcaaagatggtgagaagggtagtcctggcccccccgggcctcctggaatcccaggcacc
gtggggctacagggcccacgaggattaagaggacttccagggccactcgggccccctggg
gaccggggtcccattgggtttcggggcccccctgggaccccaggagcacctgggaaagtg
ggtgacaggggtgaaaggggaccagaagggttccgtggccctaagggtgacctgggcagg
cctggtcccaaaggaatccctggaatggctgggccaggcggagaaccaggcatgccaggc
aaggatggcaaagatggtgtgccgggacttgatggtgagaagggagaggctggtcgcaat
ggtggccaaggagagaaaggccccaatgggctgccggggctccctggacgagcagggtcc
aaaggcgagaagggagaaccgggtagaactggcgagctgggtgaggctggcccctctgga
gagccaggtatccctggagatgttggtgttccaggggagcgtggtgaggctggtcacagg
ggctccgtgggagctcttggcccacaaggtcctcctggtgctcctggcatccgtggcttt
cagggacaaaaaggcagcacaggagaccctggccttccgggcccccaaggcctacgggga
gatgtgggtgaccgggtaagggttgttctcttgcacctccctgctctaaccagtctacat
agactcaagccagcagcagcccactccttcccacgtgggtggcagggatggcagcaccaa
ctatgtggacagggtccaggaggtgccacaggccctaagggagaccagggcattgcaggt
tccgatggtcttccaggggacaaaggcgagctgggtcctaatggccccgttggacaaaaa
ggagagtctggcagccgaggggaactgggccccaaaggcatccagggccccaatggcacc
agtggagtccagggtgtacctggtcccccaggtccactgggcctccaaggtgtgcagggt
gtcccaggcatcaccgggaagcctggagttccgggcaaggaagccagtgaacagcgcatc
agggagctatgcgggggtatgatcagtgagcaaattgcacagttggctgcacacctgagg
aagcccttagcaccaggctccatcggcaggcctggtccagctggccccccaggccctcca
ggccctccaggctctattggccaccctggcgctcggggtccccctggataccgtggtccc
actggggaactaggagatcctggaccaagagggagccagggtgacagaggggacaaggga
gcaacaggtgcagggctggatgggcctgctggggaccagggctaccaagggcctcaaggt
gtacctggcatcagcaaagatggtcgagatggtgctcatggtgagcctggccttcccggt
gatcctggccttcctggagctgctggtgctcagggtaccccagggatctgcgacacttca
gcctgccaaggagctgtgttagggggaggtggggaaaagtcgggtcctcggagctcataa

KEGG   Mus musculus (mouse): 12842
Entry
12842             CDS       T01002                                 

Gene name
Col1a1, Co, Col, Col1, Col1a-1, Cola-1, Cola1, Mov-, Mov-13, Mov13
Definition
(RefSeq) collagen, type I, alpha 1
  KO
K06236  collagen type I alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12842 (Col1a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12842 (Col1a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12842 (Col1a1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    12842 (Col1a1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12842 (Col1a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    12842 (Col1a1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    12842 (Col1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12842 (Col1a1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12842 (Col1a1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12842 (Col1a1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12842 (Col1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12842 (Col1a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12842 (Col1a1)
SSDB
Motif
Pfam: Collagen COLFI VWC
Other DBs
NCBI-GeneID: 12842
NCBI-ProteinID: NP_031768
MGI: 88467
Ensembl: ENSMUSG00000001506
Vega: OTTMUSG00000002059
UniProt: P11087
Position
11 59.01 cM; 11 D
AA seq 1453 aa
MFSFVDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWKPEVCLICICHNGTAV
CDDVQCNEELDCPNPQRREGECCAFCPEEYVSPNSEDVGVEGPKGDPGPQGPRGPVGPPG
RDGIPGQPGLPGPPGPPGPPGPPGLGGNFASQMSYGYDEKSAGVSVPGPMGPSGPRGLPG
PPGAPGPQGFQGPPGEPGEPGGSGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQG
ARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERG
RPGPPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAGPQGARGSEGPQGVRG
EPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKG
NSGEPGAPGNKGDTGAKGEPGATGVQGPPGPAGEEGKRGARGEPGPSGLPGPPGERGGPG
SRGFPGADGVAGPKGPSGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDG
KTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGLPGPPGAVGPAG
KDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPG
PSGARGERGFPGERGVQGPPGPAGPRGNNGAPGNDGAKGDTGAPGAPGSQGAPGLQGMPG
ERGAAGLPGPKGDRGDAGPKGADGSPGKDGARGLTGPIGPPGPAGAPGDKGEAGPSGPPG
PTGARGAPGDRGEAGPPGPAGFAGPPGADGQPGAKGEPGDTGVKGDAGPPGPAGPAGPPG
PIGNVGAPGPKGPRGAAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPVGKEGGKGPRG
ETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGSPGTPGPQGIAGQRGVVGLPGQRGERG
FPGLPGPSGEPGKQGPSGSSGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPG
AKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQG
PRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPG
KDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQD
GGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKS
GEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMT
DGFPFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQ
GSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPD
QEFGLDIGPACFV
NT seq 4362 nt   +upstreamnt  +downstreamnt
atgttcagctttgtggacctccggctcctgctcctcttaggggccactgccctcctgacg
catggccaagaagacatccctgaagtcagctgcatacacaatggcctaagggtccccaat
ggtgagacgtggaaacccgaggtatgcttgatctgtatctgccacaatggcacggctgtg
tgcgatgacgtgcaatgcaatgaagaactggactgtcccaacccccaaagacgggagggc
gagtgctgtgctttctgcccggaagaatacgtatcaccaaactcagaagatgtaggagtc
gagggacccaagggagaccctggcccccaaggcccaaggggacccgttggcccccctgga
cgagatggcatccctggacagcctggacttcctggtcctcctggtccccctgggcccccc
ggaccccctggccttggaggaaactttgcttcccagatgtcctatggctatgatgaaaaa
tcagctggagtttccgtgcctggccccatgggtccttctggtcctcgtggtctccctggc
ccccctggtgcacctggtccacaaggtttccaaggcccccctggtgaacctggcgagcct
ggcggttcaggtccaatgggtccccgaggtccccctggccctcctggcaagaatggagat
gatggggaagctggcaagcccggccgtcctggtgagcgtggacctcctggacctcagggt
gctcgtggattgcctggaacagctggcctccctggaatgaagggacaccgaggcttcagt
ggtttggatggtgccaaaggagatgctggtcctgctggtcctaagggagagcccggcagt
cctggtgaaaacggagctcctggccagatgggtccccgaggtctgcccggtgagagaggt
cgccctggacctcctggcactgctggtgctcgcggtaacgatggtgctgttggtgctgct
ggaccccctggtcccaccggccccactggccctcctggcttccctggtgcagttggtgct
aagggtgaagctggtccccaaggagctagaggctctgaaggtccccagggtgtgcgtggt
gagcccggaccccctggccctgctggtgctgccggccctgctggaaaccctggtgctgat
ggacaacctggcgctaaaggtgccaatggtgctcctggtattgctggtgctcctggcttc
cctggtgcccgaggcccctctggaccccagggccccagcggccctccaggtcccaagggt
aacagtggtgaacctggtgctcctggcaacaaaggagacactggtgccaaaggagaaccc
ggtgctactggagttcaaggtcccccaggccctgccggagaagaaggaaaacgaggagcc
cgtggtgagcctggaccttccggactgcctggacctcctggcgagcgtggtggacctggt
agccgtggtttccctggtgctgatggtgttgctggccccaagggtccttccggtgaacgt
ggtgctcccggacctgctggtcccaaaggttctcctggtgaagctggtcgccccggtgaa
gctggtctccctggtgccaagggtctcactggcagtcctggcagccctggtcctgatggc
aaaaccggcccccctggtcccgctggtcaagatggtcgccctggacccgcaggtcctcct
ggagcccgtggccaggctggtgtgatgggattccctggacctaagggtaccgctggagaa
cctggaaaggctggagagcgaggccttcccggaccccctggcgctgttggtcctgctggc
aaagatggagaagctggagctcagggagcccctggccctgctggtcctgctggtgagaga
ggtgaacaaggtcccgctggctcccctggattccagggtcttcctggtcctgccggtcct
cctggtgaagcaggcaagcctggtgaacagggtgttcctggagaccttggtgcccctgga
ccctctggcgcaagaggcgagagaggtttccctggtgaacgtggtgtacaaggtccccca
ggtcctgctggtccccgaggaaacaatggtgcccccggcaacgatggtgccaagggtgat
actggtgcccccggagctcccggtagccagggtgcccccggtcttcagggaatgcctggt
gaacgtggtgcagctggtcttccaggtcctaagggtgacagaggtgatgctggtcccaaa
ggtgctgatggttctcctggtaaagatggtgcccgtggtctgactggtcccattggtcct
cctggccctgctggtgcccctggtgacaagggtgaagctggtcccagtggtcctcccggt
cccaccggagcccgtggtgctcccggagaccgtggtgaggctggtccccctggtcctgct
ggctttgccggcccccctggtgctgatggccaacctggtgcgaaaggtgaacctggtgat
actggtgttaaaggtgatgctggtcctcctggccctgctggtcctgctggaccccccggc
cccattggtaacgttggtgctcctggacccaaaggtcctcgtggtgctgctggtccccct
ggtgctactggcttccctggtgctgctggccgtgtcggtccccctggtccctctggaaat
gctggaccccctggccctcccggtcccgttggcaaagaagggggcaaaggtccccgtggt
gagactggccctgctggacgtcctggtgaagttggtcccccaggtccccccggtcctgct
ggtgagaaaggatctcctggtgctgatggacctgctggctctcctggtacccctggacct
cagggtattgctggacaacgtggtgtggtcggtcttcccggtcagagaggagaaagaggc
ttccctggtcttcctggcccctctggtgaacctggcaaacaaggtccttctggatcaagt
ggtgaacgcggtccccctggccccatggggccccctggattggctggtccccctggtgaa
tctggacgtgagggatcccctggtgctgaaggctcccctggaagggatggtgctcccggg
gccaagggtgaccgtggtgagactggccccgctggcccccctggtgcccctggtgctccc
ggtgctcccggccctgttggtcccgctggcaagaatggcgatcgtggtgagactggtcct
gctggtcctgctggtcccattggccctgctggtgcccgtggccctgctggaccccaaggc
ccccgtggtgacaagggtgagacaggcgaacaaggtgacagaggcataaagggtcatcgt
ggcttctctggtctccagggtcctcctggttctcctggttctcctggtgaacaaggcccc
tctggagcttcaggtcctgcaggcccccggggtccccctggctctgctggttctcctggc
aaagacggactcaacggtctccctggccccattggtccccctggtcctcgaggtcgcact
ggtgacagcggccctgctggtccccccggccctcctggaccccctggccctcctggacct
cccagtggcggttatgacttcagcttcctgcctcagccacctcaagagaagtctcaagat
ggtggccgctactaccgggccgatgatgctaacgtggttcgtgaccgtgaccttgaggtg
gacaccaccctcaagagcctgagtcagcagattgagaacatccgcagccccgaaggcagc
cgcaagaaccctgcccgcacatgccgcgacctcaagatgtgccactctgactggaagagc
ggagagtactggatcgaccctaaccaaggctgcaacctggacgccatcaaggtctactgc
aacatggagacaggtcagacctgtgtgttccctactcagccgtctgtgcctcagaagaac
tggtacatcagcccgaaccccaaggaaaagaagcacgtctggtttggagagagcatgacc
gatggattcccgttcgagtacggaagcgagggctccgaccccgccgatgtcgctatccag
ctgaccttcctgcgcctaatgtccaccgaggcctcccagaacatcacctatcactgcaag
aacagcgtagcctacatggaccagcagactggcaacctcaagaaggccctgctcctccag
ggatccaacgagatcgagctcagaggcgaaggcaacagtcgcttcacctacagcaccctt
gtggacggctgcacgagtcacaccggaacttggggcaagacagtcatcgaatacaaaacc
accaagacctcccgcctgcccatcatcgatgtggctcccttggacattggtgccccagac
caggaattcggactagacattggccctgcctgcttcgtgtaa

KEGG   Mus musculus (mouse): 12843
Entry
12843             CDS       T01002                                 

Gene name
Col1a2, AA960264, AI325291, Co, Col, Col1, Col1a-2, Cola-2, Cola2, oim
Definition
(RefSeq) collagen, type I, alpha 2
  KO
K06236  collagen type I alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12843 (Col1a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12843 (Col1a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12843 (Col1a2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    12843 (Col1a2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12843 (Col1a2)
  09154 Digestive system
   04974 Protein digestion and absorption
    12843 (Col1a2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    12843 (Col1a2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12843 (Col1a2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12843 (Col1a2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12843 (Col1a2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12843 (Col1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12843 (Col1a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12843 (Col1a2)
SSDB
Motif
Pfam: Collagen COLFI
Other DBs
NCBI-GeneID: 12843
NCBI-ProteinID: NP_031769
MGI: 88468
Ensembl: ENSMUSG00000029661
Vega: OTTMUSG00000021300
UniProt: Q01149 Q3TX57
Position
6 A1; 6 1.81 cM
AA seq 1372 aa
MLSFVDTRTLLLLAVTSCLATCQYLQSGSVRKGPTGDRGPRGQRGPAGPRGRDGVDGPMG
PPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQ
GPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLP
GFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGAR
GSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPV
GPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSK
GESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRA
GVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGID
GRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPP
GPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTP
GESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGK
GEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGER
GEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPV
GSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGET
GASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEP
GPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSI
GPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDK
GHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPV
GPAGVRGSQGSQGPAGPPGPPGPPGPPGVSGGGYDFGFEGDFYRADQPRSQPSLRPKDYE
VDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWNSDYYWIDPNQGCTMDAIKVY
CDFSTGETCIQAQPVNTPAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQL
AFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSVLV
DGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCFK
NT seq 4119 nt   +upstreamnt  +downstreamnt
atgctcagctttgtggatacgcggactctgttgctgcttgcagtaacttcgtgcctagca
acatgccaatatttgcaatcgggatcagtacgaaagggccccactggagacagaggacca
cgtggacaaaggggtcccgcaggtccccgaggcagagatggtgttgatggtcccatgggc
cctcctggtccccctggctcccctggtcctcccggctcccctgccccccctggtcttact
gggaactttgctgctcagtattctgacaaaggagtttcatctggccctggaccaatgggt
ttaatgggacccagaggccctcctggtgctgttggagcccctggccctcaaggtttccaa
ggacctgctggtgaacctggtgagcctggtcaaacgggtcctgcaggtccccgtggtcca
gctggctctcctggcaaggctggtgaggatggtcaccctggaaaacccggaagacctggg
gagagaggagtcgttggaccacagggtgctcgtggtttccccgggactcctggacttcct
ggcttcaaaggcgtgaaaggacacagtggtatggatggattaaagggacagcctggtgca
cagggtgtgaagggtgaacccggtgcccctggagagaatggaactccaggtcaagcagga
gcccgagggcttcctggtgagagagggcgtgtcggagctcctggtccagctggtgcccga
ggcagtgatggaagcgttggccccgtcggccctgctggtcccattgggtctgctggaccc
cctggtttcccaggtgctcctggtcccaagggtgaacttgggcccgttggtaaccctggc
cctgctggtcctgctggtccccgtggtgaagtgggtcttccaggtctttctggccctgtt
ggacctcctggcaaccctggaacaaatgggctcactggcgccaagggtgctactggactc
cctggtgtcgctggggctcccggtctccctggcccccgtggtattcctggccccgctggt
gctgctggtgctacaggtgccagaggacttgttggtgagcctggtcctgctggctccaaa
ggagaatccggtaacaagggtgagcctggctctgttggagcccaaggtcctcctggtccc
agcggtgaagaaggaaagagagggtctcccggagaagctggatctgctggccctgcaggg
cctccagggcttagaggcagccctggttctcgaggtcttcctggagctgatggcagagct
ggtgtaatgggtcctcctggcaatcgtggttcaaccggccctgctggaatccgaggtcct
aatggagatgccggtcgacctggggaacctggtctcatgggacccagaggtcttcctggg
tctcctggaaatgttggcccatctggtaaagaaggccctgtgggtctccctggcattgat
ggcagacctggcccaatcggcccagctggaccaagaggtgaagctggcaacatcggattc
cctggacccaaaggcccctctggtgatcctggcaaacctggtgagagaggacaccccggt
cttgctggtgctcggggagctccaggacccgatggcaacaatggagctcagggcccccct
ggaccccagggtgttcaaggtggcaaaggtgaacaaggccctgctggtcctcctggcttc
cagggtctccctggtccctcaggtactactggagaagttggcaagcccggagaaaggggt
cttcctggtgaattcggtctccctggtcctgctggtccaagaggagaacgtggtaccccg
ggtgagagtggagctgctggcccttctggtcctattggaagccgaggtcccagtggagcc
ccagggcctgatggaaacaagggtgaagctggtgcagtcggtgctccaggcagtgctggt
gcctctgggcctggtgggcttccaggagagaggggtgctgctggcatacctgggggcaaa
ggagaaaagggtgaaactggtctccgaggtgacactggcaacactggtagagatggtgct
cgtggcattcctggtgctgtaggtgcccctggtcctgctggggcctcaggtgaccggggt
gaagctggtgctgccggtccttctggcccagctggtcctcggggtagccctggtgaacgt
ggtgaagttggccctgctggccccaatggatttgctggtcctgctggtgctgctggccaa
cccggtgctaaaggagagaagggaaccaaagggcctaagggtgaaaatggcattgttggt
ccaaccgggtctgttggagctgctggcccatctggtcctaatggcccacctggtcctgtt
ggaagtcgtggtgatggagggccccctggtatgactggcttccctggtgctgctggacgg
actggtccccccggacccagtggtattgctggcccccctggcccccctggtgctgctgga
aaggaagggattcgtggtccccgtggcgaccaaggtccagttggccgaactggagaaaca
ggtgcatctggaccccctggatttgttggtgaaaagggtccctctggagaacctggtacc
gcaggagcccctggtaccgcaggtcctcagggtcttcttggtgctcccggtattctgggt
ctccctggctctagaggtgaacgtggtctgccaggtattgctggtgctctgggtgaacct
ggtcctctgggcatctcaggccctcctggtgcccgtggtccccctggtgctgtgggcagc
cctggagttaatggtgcccctggtgaagctggtcgtgatggtaaccctggcagcgatggt
cccccaggtcgtgatggtcagcctggacacaagggagagcgtggttaccctggcagcatt
ggtccgactggtgctgcaggtgcccctggtcctcacggttctgtgggtcctgctgggaaa
catggaaaccgaggtgaacctggtcctgccggttctgttggtcctgttggtgctgttggt
ccaagaggtcctagtggtcctcaaggcatccgaggtgacaaaggagaacctggtgataaa
gggcacaggggtcttcctggcttaaaaggatacagtggattgcagggtcttcctggtctt
gctggcctacatggtgaccaaggagctcctggtcctgtgggtcctgctggtcccaggggt
cctgctgggccttctggacccgttggcaaagatggtagatctgggcaacctggcccagtc
gggcctgctggtgttcgtggttctcagggtagccaaggtcccgctggtccccctggtccc
cctggacctcctggtcctcctggtgtcagcggaggtggctatgactttggttttgaagga
gacttctacagggctgaccagcctcgctcccagccttcactcagacccaaggactatgaa
gttgatgcaactctgaaatctctcaataaccagattgagacccttctcactcctgaaggc
tctagaaagaaccctgctcgcacgtgccgggacttaagactcagccacccagagtggaac
agcgattactactggattgaccctaaccaaggatgtactatggatgccatcaaagtgtac
tgtgatttctctactggtgaaacctgcatccaggcccaacctgtaaacaccccagcgaag
aactcatacagccgcgcccaggccaacaagcatgtctggttaggagagactatcaatggt
ggcagccagtttgaatacaacgtagaaggggtgtcctccaaggaaatggcaactcagctc
gccttcatgcgcctgctagccaaccgtgcttctcagaacatcacctaccactgcaagaac
agcattgcgtacctggatgaggagacgggcagcttgaacaaggctgtgcttctgcagggt
tccaacgatgttgaacttgttgctgagggcaacagcaggttcacctactctgtcctagtc
gatggctgctccaaaaagacaaatgaatggggcaagacaatcattgaatacaaaacaaat
aagccatctcgcctgccgttccttgacattgcacctctggacattggtggtgctgaccaa
gaattccgtgtggaggttggccccgtctgtttcaaataa

KEGG   Mus musculus (mouse): 12845
Entry
12845             CDS       T01002                                 

Gene name
Comp, TS, TSP5
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12845 (Comp)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12845 (Comp)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    12845 (Comp)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12845 (Comp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12845 (Comp)
  09174 Infectious disease: parasitic
   05144 Malaria
    12845 (Comp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12845 (Comp)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12845 (Comp)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12845 (Comp)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    12845 (Comp)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12845 (Comp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12845 (Comp)
  Exosomal proteins of colorectal cancer cells
   12845 (Comp)
  Exosomal proteins of bladder cancer cells
   12845 (Comp)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12845 (Comp)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   12845 (Comp)
SSDB
Motif
Pfam: TSP_C TSP_3 EGF_CA COMP cEGF EGF_3 EGF_MSP1_1
Other DBs
NCBI-GeneID: 12845
NCBI-ProteinID: NP_057894
MGI: 88469
Ensembl: ENSMUSG00000031849
Vega: OTTMUSG00000062218
UniProt: Q9R0G6
Structure
PDB: 
1MZ9 3V2N 3V2P 3V2Q 3V2R

Position
8 B3.3; 8 34.15 cM
AA seq 755 aa
MGPTACVLVLALAILRATGQGQIPLGGDLAPQMLRELQETNAALQDVRELLRQQVKEITF
LKNTVMECDACGMQPARTPGLSVRPVPLCAPGSCFPGVVCSETATGARCGPCPPGYTGNG
SHCTDVNECNAHPCFPRVRCINTSPGFHCEACPPGFSGPTHEGVGLTFAKSNKQVCTDIN
ECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQTSGCQRRGQHFCPDGSPSPCHEKAN
CVLERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQED
VDRDGIGDACDPDADGDGVPNEQDNCPLVRNPDQRNSDSDKWGDACDNCRSKKNDDQKDT
DLDGRGDACDDDIDGDRIRNVADNCPRVPNFDQSDSDGDGVGDACDNCPQKDNPDQRDVD
HDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGKGDACDDDDDNDGVPDSRD
NCRLVPNPGQEDNDRDGVGDACQGDFDADKVIDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTAMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYESHRLQRV
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgggccccactgcctgcgttctagtgctcgccctggctatcctgcgggcgacaggccag
ggccagatcccgctgggtggagacctggccccacagatgctgcgagaacttcaggagact
aatgcggcgctgcaagacgtgagagagctgttgcgacagcaggtcaaggagatcaccttc
ctgaagaatacggtgatggaatgtgatgcttgcggaatgcagcccgcacgcactccaggc
ctgagcgtgcggccagtgccgctctgcgcacccggctcctgcttccccggcgtagtctgc
tccgagacagctacgggcgcgcgctgcggcccctgccctcctggctacaccggcaacggc
tcgcactgcaccgacgttaatgagtgcaatgctcacccctgtttcccgcgggtgcggtgc
atcaataccagccctggctttcactgcgaagcctgtccccctgggttcagcggacccacc
cacgagggcgtgggactgaccttcgctaagtccaacaaacaagtttgcacggatattaat
gagtgtgagaccgggcagcacaattgcgttcccaactccgtgtgcgtcaacacccggggc
tccttccagtgcggcccctgccagcccggtttcgtgggcgaccagacgtcaggctgccag
cggcgtgggcagcacttctgccccgatgggtcacccagcccgtgccatgagaaagcaaac
tgcgtcctggagcgggatggctcgaggtcttgcgtgtgtgcagttggctgggccggcaac
gggctcctgtgcggccgcgacacggacctggacggttttcctgacgagaagcttcgctgc
tcagagcgccagtgtcgcaaggacaactgcgtgacggtgcccaattcggggcaggaggat
gtggaccgggacggcatcggagatgcttgtgacccggatgcggacggggatggagtccct
aacgagcaagacaattgcccgctggttcgaaacccagaccagcgtaactcggacagtgat
aagtggggagatgcctgcgacaactgccggtccaagaagaatgacgatcagaaagataca
gacctggatggccggggcgatgcctgcgacgacgacatagatggcgaccgaatacgaaat
gtagctgacaactgtccccgggtgcccaactttgaccagagtgacagtgatggtgatggt
gttggggatgcctgtgacaactgtccccagaaagataacccagaccagagggatgtggac
cacgactttgtgggtgatgcctgtgatagtgaccaagaccaggatggggatggtcaccag
gactcccgggacaactgccccacagtacccaacagtgcccagcaggactcagatcatgat
ggcaagggcgatgcctgtgatgacgatgatgacaatgacggagttcctgatagccgggac
aactgccgcttggtgcctaaccctggccaagaggacaatgaccgggatggcgtgggtgac
gcgtgtcagggtgacttcgatgctgacaaggttatagacaagatcgatgtgtgccccgag
aacgccgaggtcaccctcaccgacttcagggccttccagacggttgtgttggaccccgag
ggtgatgcgcagatcgatcccaactgggtggtgctcaatcagggaatggagatcgttcag
accatgaacagtgaccctggcctggctgtgggttacacagccttcaacggcgtggacttc
gagggcacattccatgtaaacaccgccactgatgatgactatgctggtttcatcttcggc
taccaagacagctccagtttctacgtagtcatgtggaaacagatggagcagacgtactgg
caggccaatcccttccgggctgtggctgagccagggattcagctcaaggctgtcaagtcc
tctacaggtcccggggaacagctccgaaacgcactgtggcacacgggggacacagcatcc
caggtgcggctgctgtggaaggatcctcgaaacgtgggctggaaggataaaacatcctac
cgctggttcctgcagcaccggcctcaagttggctacatcagggtgcggttctatgagggt
cctgagctagtagctgacagcaatgtggtgttggacacggccatgcgtggtggccgcctg
ggtgtcttctgcttctcccaagagaacatcatctgggctaacctgcgctaccgttgcaat
gatacaatccctgaggactacgagagtcaccggctgcagagagtctag

KEGG   Mus musculus (mouse): 14268
Entry
14268             CDS       T01002                                 

Gene name
Fn1, E330027I09, F, Fn, Fn-, Fn-1
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05100  Bacterial invasion of epithelial cells
mmu05135  Yersinia infection
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    14268 (Fn1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    14268 (Fn1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14268 (Fn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14268 (Fn1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14268 (Fn1)
   05205 Proteoglycans in cancer
    14268 (Fn1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    14268 (Fn1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14268 (Fn1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    14268 (Fn1)
   05100 Bacterial invasion of epithelial cells
    14268 (Fn1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    14268 (Fn1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    14268 (Fn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14268 (Fn1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14268 (Fn1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14268 (Fn1)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    14268 (Fn1)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    14268 (Fn1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   14268 (Fn1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   14268 (Fn1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   14268 (Fn1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF4959
Other DBs
NCBI-GeneID: 14268
NCBI-ProteinID: NP_034363
MGI: 95566
Ensembl: ENSMUSG00000026193
Vega: OTTMUSG00000048807
UniProt: P11276 Q3UZF9
Structure
PDB: 
2MFN 1MFN

Position
1 C3; 1 36.05 cM
AA seq 2477 aa
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKPGCFDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYKVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAGSGSFTDVRTAIYQPQTHP
QPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGNSNGALC
HFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKFVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRPKTSTGRWKEATIP
GHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTRFDFTTSASTPVTSNTVTGETAPYSPV
VATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL
PGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGT
PRSDNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTF
AEITGLSPGVTYLFKVFAVHQGRESNPLTAQQTTKLDAPTNLQFVNETDRTVLVTWTPPR
ARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEYTVTLVAVKGNQQSPKATGV
FTTLQPLRSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYTYTIQVLRDGQERDAPIVNRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISD
TVVPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVG
YYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPP
PSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIPL
RGRQKTGLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSR
NSITLTNLNPGTEYVVSIIAVNGREESPPLIGQQATVSDIPRDLEVIASTPTSLLISWEP
PAVSVRYYRITYGETGGNSPVQEFTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPAS
SKPVSINYKTEIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTA
SPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKI
AWESPQGQVSRYRVTYSSPEDGIRELFPAPDGEDDTAELQGLRPGSEYTVSVVALHDDME
SQPLIGIQSTAIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINL
SPDSSSVIVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENVSPPRRARVTDATETTI
TISWRTKTETITGFQVDAIPANGQTPVQRSISPDVRSYTITGLQPGTDYKIHLYTLNDNA
RSSPVIIDASTAIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPR
PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEI
LDVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPVR
LRPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESS
EYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTV
GNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKW
CHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK
EYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPI
ECFMPLDVQADRDDSRE
NT seq 7434 nt   +upstreamnt  +downstreamnt
atgctcaggggtccgggacccgggcggctgctgctgctggcagtcctgtgcctggggacc
tcggtgcgctgcaccgaagccgggaagagcaagaggcaggctcagcaaatcgtgcagcct
caatccccggtggctgtcagtcagagcaagcctggctgttttgacaatgggaagcactat
cagataaatcagcagtgggaacggacctacctaggcaacgccctggtttgtacctgctat
ggaggaagccggggttttaactgcgagagcaagcctgagcctgaagagacttgctttgac
aaatacactgggaacacttacaaagtgggtgacacttatgagcgccctaaagattccatg
atctgggactgtacctgcatcggggctgggagaggcaggatcagctgtaccattgcaaat
cgctgccatgaagggggtcagtcctacaagattggcgacaagtggaggaggccacatgag
actggtggctacatgttagagtgtctgtgtctgggaaatggaaaaggggaatggacctgc
aaacctatagctgagaagtgttttgatcatgctgctgggacgtcctacgtcgtgggggag
acctgggaaaagccctaccaaggctggatgatggtggactgtacttgtctaggcgaaggc
aatggacgcatcacctgtacctccagaaacagatgcaacgatcaggacacccggacatcc
tataggattggagacacgtggagcaagaaggacaaccgaggaaacctgcttcagtgtgtc
tgcacaggcaatggcagaggggagtggaagtgtgagcgacatgctctacaaagtgcttca
gccggatctggctccttcactgatgtccgaacagctatttaccaaccgcagactcacccc
cagcccgctccctacggccactgtgtcaccgacagtggtgtggtctactctgtgggaatg
cagtggctgaagtcgcaaggaaacaagcaaatgctgtgcacgtgcctgggcaatggcgtc
agctgccaggagacagccgtgacccagacttatggtggcaattcaaacggggagccctgt
gtcctcccgttcacctacaacggtaggaccttctattcctgcaccaccgaagggcggcaa
gacggacatctgtggtgtagcacaacttccaattacgaacaagaccagaagtattccttc
tgcacagaccatgcggttttggttcagactcgaggcggaaattccaatggtgctctgtgc
cacttccccttcctgtacaacaaccggaattacaccgactgtacttctgagggtcgcagg
gacaacatgaaatggtgcggcaccacccagaactacgatgccgatcagaagtttggattc
tgcccaatggctgcccacgaggagatctgcacaaccaatgaaggggtcatgtatcgcatt
ggggatcagtgggataagcagcatgacctgggccacatgatgaggtgcacgtgtgtgggg
aacggtcgtggagaatgggcctgcatcccctactcccagctccgagaccagtgcatcgtt
gatgacattacttacaatgtgaacgacacgttccacaagcgtcacgaggagggacatatg
ctgaactgtacctgctttggtcagggccggggcagatggaagtgtgaccccattgaccag
tgccaagattcagagacccggacattttaccagattggtgactcctgggagaagtttgtg
catggtgtccgataccagtgttactgctacggccgtggcatcggggagtggcactgtcaa
cctctgcagacctacccaggcacaactggacctgtccaagtaattatcacggagaccccc
agccagcccaattcccaccccatccagtggaatgccccggagccttcacacatcaccaag
tacattctcagatggagacctaaaacctctacgggtcgctggaaggaagctaccattcct
ggccaccttaactcctataccatcaaaggcctgaccccaggtgtgatctatgagggacag
ctcatcagcatccagcagtatggccacagagaagtgacacgcttcgacttcaccaccagc
gccagcacccctgtgaccagcaacacggtgaccggagagactgcgccctactctcctgtt
gtggccacttctgaatctgtaactgaaatcacagccagcagctttgtggtctcatgggtc
tcagcctccgacaccgtgtcaggcttccgggtggagtatgagctgagcgaggagggagat
gaaccacagtaccttgatctcccaagcacggccacttccgtgaacattcctgacctgctc
ccgggcagaaagtacattgtcaatgtctatcagatatctgaggagggaaaacagagcttg
atcctgtctacctcacagactacagcacctgacgctcctccagaccctaccgtggaccag
gttgatgatacttccattgttgttcggtggagtagaccccaggcacctatcacagggtat
agaattgtctattcaccttcagtagaaggcagtagcacagagctcaacctccctgaaacg
gccaactccgtcaccctcagcgacctgcagcccggtgttcagtacaacatcactatctat
gctgtggaggagaaccaggagagcacacccgttttcatccaacaagagaccactggcacc
ccaagatctgataacgtcccccctccgacggacctacagtttgtggaactgactgatgtg
aaagtcaccatcatgtggacccctcctgatagtgtggtgtctggataccgtgtggaggtc
ctgcctgtcagcctgcccggggaacatgggcagaggctgcctgtcaacagaaataccttt
gctgaaatcactgggctgtcccctggggtcacgtacctcttcaaagtctttgctgtgcac
cagggcagggaaagcaatcctctgacggcacaacagaccaccaaactcgacgctcccact
aacctccagtttgtcaatgaaactgacagaacagttctggtaacgtggactccacctcga
gcccgtatagcaggctaccgactgaccgcgggcctgacccgaggaggccagcccaagcag
tacaatgtgggacccttggcctccaagtatcccctgagaaatctgcagcctgggtctgag
tacaccgtgaccttggtggctgtgaaagggaaccagcagagtcccaaagccaccggagtc
tttactaccctgcagcctctgcgctccattccaccttacaacaccgaggtgacagagacc
acaattgtgatcacctggacccccgctccaaggattggcttcaagctgggtgtacgaccg
agccagggaggtgaggcaccccgagaagtgacttcagactctgggagcattgttgtgtct
ggcttgactccaggcgtggaatacacttacaccatccaagtcctgcgagatggccaggag
agagatgcaccgattgtcaacagagtagtgacaccgctgtctccaccgaccaacttgcat
ctggaggcaaaccctgacactggagtgcttactgtctcctgggagaggagcactacccca
gatatcactggctacagaataactactacccccacgaacgggcagcaggggacctctctg
gaagaagtggtccatgctgatcagagttcctgcacttttgagaacctgaatcctggcctg
gagtacaacgtcagtgtttacactgtcaaagatgacaaggaaagtgcccctatctctgat
accgttgtcccagaggtgccccagctcactgacctaagctttgttgatataactgattca
agcatcggcctgaggtggaccccgctaaactcttccaccattatcgggtaccgaatcaca
gtagttgcggcaggagaagggatccctatttttgaagattttgtggactcctcagtagga
tactacacagttacagggctggagcctggcattgactatgacatcagcgttatcactctc
attaatggcggagagagtgcccctactacactgacacagcaaacggctgtccctcctccc
acggatctgcgattcaccaatatcggtccagacacgatgcgggtcacttgggccccgcct
ccgtccatcgagctgaccaacctcttggtgcgctactcacccgtgaagaatgaagaggac
gttgcagagctatccatttcaccttcagacaatgccgtggtcctaacaaatctcctgcct
gggacagaatacttagtcagtgtctccagtgtctacgaacaacatgagagcatccctctc
cggggaaggcagaaaacaggtctcgattccccaactggttttgattcttctgatatcacc
gccaactcattcactgtccactgggtggctcctcgggcccccatcaccggctacatcatc
cgccatcacgccgagcattctgtcggaagacccaggcaggatcgagtgccgccctcgcgg
aattccatcaccctcaccaaccttaatccgggcaccgagtacgttgtcagcatcattgct
gttaatggcagagaggagagcccgccactgattggccagcaagccacagtttctgatatt
ccgagagatctggaggtcattgcctccacccccaccagcctgctcatcagttgggaaccc
cctgccgtctctgtgcgctattacagaatcacctacggagagacaggaggaaatagccct
gtccaggagttcactgtgcccggaagcaagtccacagccaccatcaacaacattaaacca
ggagcagactacaccatcaccctgtatgctgtcactggccgtggggacagtccagcaagc
agcaagccagtttccatcaattataaaacagaaattgacaagccgtcccagatgcaggtg
acagatgtccaggacaacagcatcagtgtcaggtggctgccttcaacttctcctgtgaca
ggctacagagtgaccaccactcccaaaaatggcctaggaccatcaaaaactaaaactgcc
agtccagatcaaacagaaatgaccattgaaggtttgcaacccactgtggagtacgtggtt
agtgtttatgctcagaaccggaacggagaaagccagcccctggttcaaactgcagtgacc
aacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaaatt
gcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccctgag
gatggaatccgggagcttttccctgcacctgatggtgaagacgacactgcagagctgcag
ggcctcaggccggggtctgagtacacagtcagtgtggttgccttgcacgatgatatggag
agccagcccctgattggaatccagtccacagccattcctgcgcccaccaatctgaagttc
agtcaggtgacacccaccagctttactgcccagtggatagcacccagtgttcagctcact
ggctaccgggtgcgggtgaacccgaaagagaagacaggaccaatgaaagaaatcaacctt
tctccagacagctcatcggtgattgtgtcaggactcatggtggccactaaatacgaagtc
agtgtctatgctctcaaggacacactgacaagcagaccagcccagggagtcatcactact
ctggagaatgttagccctccaagaagggcccgtgtgacggacgctacagagaccaccatc
actattagctggagaacaaagacagagacaatcactggcttccaagtcgatgccatccca
gccaatggccagaccccagttcagaggagcatcagcccggatgttagaagctacaccatt
acaggtttacagccaggcactgactacaagatccacctgtacactctgaacgacaatgcc
cggagctcgcccgtgatcatcgatgcctccaccgccatcgacgcaccatccaacctgcgg
ttcctgaccaccacacccaactccttgctggtgtcatggcaggcgccccgtgccaggatt
actggctacattatcaagtatgagaagcctggatcccctcccagagaagtggtccctcgg
ccccgccctggtgtcacggaggccaccattactggtctggagccaggaaccgagtacacc
atctacgtcattgccctgaagaacaatcagaagagtgagcccctgattgggaggaagaag
acagatgagcttccccaactggttacccttccacaccccaatcttcatggaccagagatc
ttggatgttccctccacagttcaaaagacccccttcatcaccaaccctgggtatgacacc
gaaaatggtattcagcttcctggcacaacccaccagcaacccagtgttgggcaacaaatg
atctttgaggaacatggctttaggcggacaacgccacccactgcggccacccccgtcagg
cttaggccaagaccatacctgccgaatgtagatgaggaggtccaaatcggtcatgttccc
aggggagacgtagactaccacctctatcctcatgttccgggcctcaatccaaatgcctct
acaggacaggaagctctctctcagacaaccatctcttggacgccgttccaggagagttct
gagtacatcatttcatgccaaccagttggcaccgacgaagagcccttacagttccaagtt
cctggaacttctaccagtgcgactctgactggccttaccagaggggtcacctacaacatc
atagtggaggcactgcagaaccagaggaggcacaaggttcgggaagaggttgtgactgtg
ggcaacgctgtcagcgaaggcctgaaccagcctacagatgactcatgctttgacccttac
acggtttcccattacgccattggagaggagtgggagcggttgtctgacgctggctttaag
ctcacatgccagtgcttgggctttggcagtggtcatttcagatgcgattcatctaaatgg
tgccatgacaacggtgtcaactacaagatcggagagaagtgggatcggcagggagaaaat
ggccagcggatgagctgcacatgcctcgggaatggaaagggagaattcaagtgtgatccc
catgaagcaacgtgctatgacgatgggaagacctaccatgtaggagaacagtggcagaaa
gaatatctcggagccatttgctcctgcacgtgtttcggaggccagcggggctggcgctgt
gacaactgccgtagacctggggctgctgaacccagtcccgatggcaccaccggccacacc
tacaaccagtatacacagagatacaatcagagaacaaacactaacgtaaattgccccatt
gagtgcttcatgccgctagatgtgcaagctgacagagacgattctcgagagtaa

KEGG   Mus musculus (mouse): 15891
Entry
15891             CDS       T01002                                 

Gene name
Ibsp, B, BSP, BSP_II, BSPII, Bs, Bsp2
Definition
(RefSeq) integrin binding sialoprotein
  KO
K06253  integrin binding sialoprotein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    15891 (Ibsp)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    15891 (Ibsp)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    15891 (Ibsp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    15891 (Ibsp)
SSDB
Motif
Pfam: BSP_II Cnd2
Other DBs
NCBI-GeneID: 15891
NCBI-ProteinID: NP_032344
MGI: 96389
Ensembl: ENSMUSG00000029306
Vega: OTTMUSG00000021399
UniProt: Q61711
Position
5 E5; 5 50.68 cM
AA seq 324 aa
MKTALILLSILGMACAFSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPV
QGGSDSSEENGDGDSSEEEGEEEETSNEEENNEDSEGNEDQEAEAENSTLSTLSGVTASY
GAETTPQAQTFELAALQLPKKAGDAESRAPKVKESDEEEEEEEEEEENENEEAEVDENEL
AVNGTSTNSTEVDGGNGSSGGDNGEEAEAEEASVTEAGAEGTTGGRELTSVGTQTAVLLN
GFQQTTPPPEAYGTTSPPIRKSSTVEYGGEYEQTGNEYNNEYEVYDNENGEPRGDTYRAY
EDEYSYYKGHGYEGYEGQNYYYHQ
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaagactgctttaattttgctcagcattttgggaatggcctgtgctttctcgatgaaa
aatttccatcgaagaatcaaagcagaggattctgaagaaaacggggtctttaagtaccgg
ccacgctactttctttataagcatgcctacttttatcctcctctgaaacggtttccagtc
cagggaggcagtgactcttcagaagaaaatggagacggcgatagttccgaagaggagggg
gaggaagaggagacttcaaacgaagaggaaaacaatgaagattctgaggggaatgaagac
caggaggcggaggcagagaactccacactttccacactctcgggtgtaacagctagctac
ggagcagagaccacaccccaagcacagacttttgagttagcggcactccaactgcccaag
aaggctggagatgcagaaagcagggctccaaaagtgaaggaaagcgacgaggaagaagaa
gaagaagaggaagaggaagaaaatgagaacgaagaagcagaagtggatgaaaacgagctg
gcggtcaacggcaccagcaccaactccacggaggtggatggcgggaatggcagcagcgga
ggagacaacggagaagaagccgaagcagaggaggcaagcgtcactgaagcaggtgcagaa
ggaaccacagggggcagggaactgaccagtgttggcacccagacagctgtccttctgaac
gggtttcagcagacaaccccaccgcccgaagcctatgggaccacctcgccaccgatcaga
aaaagcagcaccgttgagtatgggggagaatacgaacaaacaggcaacgaatacaacaat
gagtatgaagtctatgacaacgagaacggggagcctcgtggcgacacttaccgagcttat
gaggatgaatacagctactacaaggggcatggctatgaaggctacgagggtcagaattat
tactaccatcagtga

KEGG   Mus musculus (mouse): 16772
Entry
16772             CDS       T01002                                 

Gene name
Lama1, AA408497, L, Lama
Definition
(RefSeq) laminin, alpha 1
  KO
K05637  laminin, alpha 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16772 (Lama1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16772 (Lama1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16772 (Lama1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16772 (Lama1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16772 (Lama1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16772 (Lama1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16772 (Lama1)
   05145 Toxoplasmosis
    16772 (Lama1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16772 (Lama1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16772 (Lama1)
   05414 Dilated cardiomyopathy
    16772 (Lama1)
   05416 Viral myocarditis
    16772 (Lama1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_B Laminin_N Laminin_II Laminin_G_3 DUF2520 Hepar_II_III
Other DBs
NCBI-GeneID: 16772
NCBI-ProteinID: NP_032506
MGI: 99892
Ensembl: ENSMUSG00000032796
UniProt: P19137
Structure
PDB: 
5MC9 2JD4

Position
17 E1.1; 17 38.8 cM
AA seq 3083 aa
MRGSGTGAALLVLLASVLWVTVRSQQRGLFPAILNLATNAHISANATCGEKGPEMFCKLV
EHVPGRPVRHAQCRVCDGNSTNPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTVTLDL
RQVFQVAYIIIKAANAPRPGNWILERSVDGVKFKPWQYYAVSDTECLTRYKITPRRGPPT
YRADNEVICTSYYSKLVPLEHGEIHTSLINGRPSADDPSPQLLEFTSARYIRLRLQRIRT
LNADLMTLSHRDLRDLDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDEEAKQLQCQCE
HNTCGESCDRCCPGYHQQPWRPGTISSGNECEECNCHNKAKDCYYDSSVAKERRSLNTAG
QYSGGGVCVNCSQNTTGINCETCIDQYYRPHKVSPYDDHPCRPCNCDPVGSLSSVCIKDD
RHADLANGKWPGQCPCRKGYAGDKCDRCQFGYRGFPNCIPCDCRTVGSLNEDPCIEPCLC
KKNVEGKNCDRCKPGFYNLKERNPEGCSECFCFGVSGVCDSLTWSISQVTNMSGWLVTDL
MSTNKIRSQQDVLGGHRQISINNTAVMQRLTSTYYWAAPEAYLGNKLTAFGGFLKYTVSY
DIPVETVDSDLMSHADIIIKGNGLTISTRAEGLSLQPYEEYFNVVRLVPENFRDFDTRRE
IDRDQLMTVLANVTHLLIRANYNSAKMALYRLDSVSLDIASPNAIDLAVAADVEHCECPQ
GYTGTSCEACLPGYYRVDGILFGGICQPCECHGHASECDIHGICSVCTHNTTGDHCEQCL
PGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVVCDQCAPGYSGSWCERCAD
GYYGNPTVPGGTCVPCNCSGNVDPLEAGHCDSVTGECLKCLWNTDGAHCERCADGFYGDA
VTAKNCRACDCHENGSLSGICHLETGLCDCKPHVTGQQCDQCLSGYYGLDTGLGCVPCNC
SVEGSVSDNCTEEGQCHCGPGVSGKQCDRCSHGFYAFQDGGCTPCDCAHTQNNCDPASGE
CLCPPHTQGLKCEECEEAYWGLDPEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQS
CHQCSLGYRSFPDCVPCGCDLRGTLPDTCDLEQGLCSCSEDGGTCSCKENAVGPQCSKCQ
AGTFALRGDNPQGCSPCFCFGLSQLCSELEGYVRTLITLASDQPLLHVVSQSNLKGTIEG
VHFQPPDTLLDAEAVRQHIYAEPFYWRLPKQFQGDQLLAYGGKLQYSVAFYSTLGTGTSN
YEPQVLIKGGRARKHVIYMDAPAPENGVRQDYEVRMKEEFWKYFNSVSEKHVTHSDFMSV
LSNIDYILIKASYGQGLQQSRIANISMEVGRKAVELPAEGEAALLLELCVCPPGTAGHSC
QDCAPGYYREKLPESGGRGPRPLLAPCVPCNCNNHSDVCDPETGKCLSCRDHTSGDHCEL
CASGYYGKVTGLPGDCTPCTCPHHPPFSFSPTCVVEGDSDFRCNACLPGYEGQYCERCSA
GYHGNPRAAGGSCQTCDCNPQGSVHSDCDRASGQCVCKPGATGLHCEKCLPRHILMESDC
VSCDDDCVGPLLNDLDSVGDAVLSLNLTGVSPAPYGILENLENTTKYFQRYLIKENAKKI
RAEIQLEGIAEQTENLQKELTRVLARHQKVNAEMERTSNGTQALATFIEQLHANIKEITE
KVATLNQTARKDFQPPVSALQSMHQNISSLLGLIKERNFTEMQQNATLELKAAKDLLSRI
QKRFQKPQEKLKALKEANSLLSNHSEKLQAAEELLKEAGSKTQESNLLLLLVKANLKEFQ
EKKLRVQEEQNVTSELIAKGREWVDAAGTHTAAAQDTLTQLEHHRDELLLWARKIRSHVD
DLVMQMSKRRARDLVHRAEQHASELQSRAGALDRDLENVRNVSLNATSAAHVHSNIQTLT
EEAEMLAADAHKTANKTDLISESLASRGKAVLQRSSRFLKESVSTRRKQQGITMKLDELK
NLTSQFQESMDNIMKQANDSLAMLRESPGGMREKGRKARELAAAANESAVKTLEDVLALS
LRVFNTSEDLSRVNATVQETNDLLHNSTMTTLLAGRKMKDMEMQANLLLDRLKPLKTLEE
NLSRNLSEIKLLISRARKQVASIKVAVSADRDCIRAYQPQTSSTNYNTLILNVKTQEPDN
LLFYLGSSSSSDFLAVEMRRGKVAFLWDLGSGSTRLEFPEVSINNNRWHSIYITRFGNMG
SLSVKEASAAENPPVRTSKSPGPSKVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMG
EAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDSSFHFDGSGYAMVEKTLRPTVTQIVILF
STFSPNGLLFYLASNGTKDFLSIELVRGRVKVMVDLGSGPLTLMTDRRYNNGTWYKIAFQ
RNRKQGLLAVFDAYDTSDKETKQGETPGAASDLNRLEKDLIYVGGLPHSKAVRKGVSSRS
YVGCIKNLEISRSTFDLLRNSYGVRKGCALEPIQSVSFLRGGYVEMPPKSLSPESSLLAT
FATKNSSGILLVALGKDAEEAGGAQAHVPFFSIMLLEGRIEVHVNSGDGTSLRKALLHAP
TGSYSDGQEHSISLVRNRRVITIQVDENSPVEMKLGPLTEGKTIDISNLYIGGLPEDKAT
PMLKMRTSFHGCIKNVVLDAQLLDFTHATGSEQVELDTCLLAEEPMQSLHREHGELPPEP
PTLPQPELCAVDTAPGYVAGAHQFGLSQNSHLVLPLNQSDVRKRLQVQLSIRTFASSGLI
YYVAHQNQMDYATLQLQEGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTEYIKRKAFMT
VDGQESPSVTVVGNATTLDVERKLYLGGLPSHYRARNIGTITHSIPACIGEIMVNGQQLD
KDRPLSASAVDRCYVVAQEGTFFEGSGYAALVKEGYKVRLDLNITLEFRTTSKNGVLLGI
SSAKVDAIGLEIVDGKVLFHVNNGAGRITATYQPRAARALCDGKWHTLQAHKSKHRIVLT
VDGNSVRAESPHTHSTSADTNDPIYVGGYPAHIKQNCLSSRASFRGCVRNLRLSRGSQVQ
SLDLSRAFDLQGVFPHSCPGPEP
NT seq 9252 nt   +upstreamnt  +downstreamnt
atgcgcggcagcggcacgggagccgcgctcctggtgctcctggcctcggtgctctgggtc
accgtgcggagccagcagagaggcttgttccctgccattctcaacctggccaccaatgcc
cacatcagcgccaatgctacctgtggagagaaggggcctgagatgttctgcaaactcgtg
gagcacgtgccgggccggcctgttcgacacgcccaatgccgggtctgtgacggtaacagt
acgaatcctagagagcgccatccgatatcacacgcaatcgatggcaccaacaactggtgg
cagagccccagtattcagaatgggagagagtatcactgggtcactgtcaccctggactta
cggcaggtctttcaagttgcatacatcatcattaaagctgccaatgcccctcggcctgga
aactggattttggagcgctccgtggatggcgtcaagttcaaaccctggcagtactatgcc
gtcagcgatacagagtgtttgacccgctacaaaataactccacggcggggacctcccact
tacagagcagacaacgaagtcatctgcacctcgtattattcaaagctggtgccacttgaa
catggagagattcacacatcactcatcaatggcagacccagcgctgacgacccctcaccc
cagttgctggaattcacctcagcacggtacattcgccttcgtctgcagcgcatcagaaca
ctcaacgcagacctcatgacccttagccatcgggacctcagagaccttgaccccattgtc
acaagacgttattactattcgataaaagacatttccgttggaggcatgtgcatttgctac
ggccatgccagcagctgcccgtgggatgaagaagcaaagcaactacagtgtcagtgtgaa
cacaatacgtgtggcgagagctgcgacaggtgctgtcctggctaccatcagcagccctgg
aggcccggaaccatttcctccggcaacgagtgtgaggaatgcaactgtcacaacaaagcc
aaagattgttactatgacagcagtgttgcaaaggagaggagaagcctgaacactgccggg
cagtacagtggaggaggggtttgtgtcaactgctcgcagaataccacagggatcaactgt
gaaacctgtatcgaccagtattacagacctcacaaggtatctccttatgatgaccaccct
tgccgtccctgtaactgtgaccctgtggggtctctgagttctgtctgtatcaaggatgac
cgccatgccgatttagccaatggaaagtggccaggtcagtgtccatgtaggaaaggttat
gctggagataaatgtgaccgctgccagtttggctaccggggtttcccaaattgcatcccc
tgtgactgcaggactgtcggcagcctgaatgaggatccatgcatagagccgtgtctttgt
aagaaaaatgttgagggtaagaactgtgatcgctgcaagccaggattctacaacttgaag
gaacgaaaccccgagggctgctccgagtgcttctgcttcggtgtctctggtgtctgtgac
agcctcacgtggtccattagtcaggtgaccaatatgtcagggtggctggtcactgacttg
atgagcacaaataagatccggtcccagcaagatgtcctgggtgggcaccgtcagatcagc
atcaacaacacggcggtcatgcagaggctgacttccacttactactgggcagctcctgag
gcctacctcggaaacaagctgacagcatttggcggtttcctgaaatacactgtgtcttac
gacattccagtggagacggtggacagtgacctcatgtctcatgctgacatcatcatcaag
gggaatgggctcaccataagcacaagagctgagggcctgtccttgcaaccctatgaggaa
tacttcaacgtggttagacttgtgcctgagaacttccgggactttgataccagaagggag
attgaccgtgaccagctgatgactgtcctggccaatgtgacacatctcttgatcagagcc
aattataattctgctaaaatggcgctctataggctggattctgtctctctggacatagca
agccctaatgctatagacttggcagtggctgctgatgtggaacactgtgaatgtccccaa
ggctacacggggacctcctgtgaggcctgcctccctggctattatcgagtagacgggata
ctctttggaggaatctgtcagccctgcgagtgccacgggcatgcatccgagtgtgacatt
catggaatttgctctgtgtgtacacacaacaccacgggggatcactgtgagcagtgcctg
cctggcttctatgggacaccttcacgtgggaccccaggagactgccagccttgtgcctgc
cctctctccattgactctaacaatttcagccctacctgccacctcactgatggagaggaa
gtggtttgtgaccagtgtgccccgggttactcaggatcctggtgtgagagatgtgcagat
ggttactatggaaacccaaccgtgccagggggaacctgtgtaccatgcaactgcagtggc
aatgttgatcccttggaggctggccactgtgactctgtcacaggggaatgcctgaagtgc
ttatggaacacagacggtgcccattgtgagaggtgtgcagatggcttctatggagatgcc
gtgactgccaaaaactgccgagcctgtgactgccacgagaatggctccctttctggcatc
tgccatctggagactggactgtgtgactgcaaacctcacgtgacaggacagcagtgtgac
cagtgcctgtctggctactacgggttggacacggggcttggctgtgtgccctgtaactgc
agtgtggaaggctctgtatctgacaactgcacggaggaaggacagtgtcactgtggacca
ggtgtctctgggaaacagtgtgacaggtgttcacacggtttctatgcattccaggatggc
ggctgcacaccctgtgactgtgctcatacccagaataactgtgaccccgcctctggagag
tgtctctgcccgcctcacacgcaggggctgaagtgtgaggagtgtgaagaggcatactgg
ggtctggacccggagcaggggtgccaggcttgcaattgcagtgctgtgggctccacgagt
gcccagtgtgatgttctctctggccactgcccctgcaaaaaagggtttggtgggcagagc
tgccatcagtgttccctaggctacagaagttttcctgactgtgtcccctgtggctgtgac
ctgagggggacactgcctgacacctgcgacctggaacagggtctctgcagctgctcagag
gacggtggtacctgctcctgcaaggagaatgccgtgggcccccagtgcagtaagtgccaa
gccggcacctttgccttgcgaggggacaaccctcaaggctgcagcccctgcttctgcttc
ggtctgtcgcagctctgctcagagttggagggttacgtgaggactctgataactctagcc
tccgatcagcccctcctgcatgtggtttcacagagcaacctcaagggcacaatcgaaggc
gtgcatttccagcctcctgacaccttgctggacgcagaggctgtccgccagcatatctat
gcagagccattttactggcggctaccaaagcagttccagggagaccagctcttggcttat
ggtgggaaactccagtacagtgtggctttctactctacacttggcaccggaacatccaat
tatgagcctcaagtcctcatcaaaggaggtcgggccaggaagcacgtcatttatatggat
gccccagcgcctgagaatggagtgagacaggattacgaagtgcggatgaaagaggaattc
tggaaatattttaactccgtgtctgagaaacatgtcacacactctgattttatgtctgtt
ctcagcaatattgactacatcctcatcaaagcatcatacggccagggactgcagcagagc
agaattgccaacatttccatggaggttggccggaaagctgtcgagctgcccgctgagggc
gaggcggcattgctgttggagctctgtgtctgtcctcctggcaccgcaggacactcctgt
caggactgtgctcctgggtactacagagaaaagctcccagaaagtggtggcaggggaccc
cgccctctgctggctccttgtgtgccctgcaattgcaacaaccacagtgatgtctgtgac
cccgaaactggaaagtgcctgagctgcagggaccacacatccggggaccactgtgagctg
tgtgcttctggctactatgggaaggtgactggactgcctggagactgtaccccgtgcacc
tgtcctcatcaccctcctttcagtttcagccccacttgtgtcgtggaaggtgacagtgat
ttccggtgcaatgcctgcctccccggctatgaaggacagtactgtgaaaggtgctctgca
ggctatcacggcaaccctcgagcagcaggtggtagctgccaaacgtgtgattgcaacccc
caaggctctgtccacagtgactgtgaccgtgcatccgggcagtgtgtctgcaagccagga
gctacagggctccactgtgagaaatgcctgccgagacacatcctgatggagagcgactgt
gtttcctgtgatgatgactgtgtgggtcctttgctgaacgacctggattctgttggtgat
gccgttctgtctctgaacctcacgggcgtttcccctgctccctatggaatcctggaaaat
ctggaaaatacaactaaatatttccagaggtatttaataaaggaaaatgccaagaagatt
cgagcagagatccagctcgaagggattgcagagcaaacagaaaatctgcaaaaggagctc
accagagtgttagcacgccatcagaaggtgaacgctgaaatggaaagaacttccaatggg
actcaagccctggccacgttcattgagcagctacatgcaaacatcaaagaaatcacagaa
aaggtggcaacgttgaaccagacggcgcgtaaagatttccagccacccgtgtctgccctt
cagagcatgcaccagaacatttcgtctctgctgggactcatcaaggaaaggaatttcaca
gagatgcagcagaatgctacccttgagctcaaggctgctaaagacttattgtcacggatt
cagaaaaggtttcagaagcctcaggaaaagttgaaggcattgaaggaggccaacagcctc
ctttccaaccacagtgaaaaactgcaggctgctgaggagctccttaaggaagctggaagc
aagacccaggagagcaacctcctgctgctccttgtcaaggccaacctgaaagaattccag
gagaaaaagctgcgtgttcaagaagaacaaaatgtgacctcagagctcattgccaagggt
agagaatgggtggatgctgccgggactcacacagctgctgcacaagacaccctaacacag
ctggagcatcaccgagatgaactccttctgtgggccagaaaaatcaggagccacgtagat
gacctcgtcatgcagatgtccaaacgaagagcccgtgacctggtccacagggcagagcag
catgcctctgagctgcagagcagggcaggagctttggacagagaccttgaaaatgttaga
aacgtgtctttgaatgccaccagtgcggcacacgtccacagcaacatccagacactgaca
gaggaagctgagatgctggctgctgatgctcacaagacggcgaataagacagacttgatc
tccgaatccctggcttctcgggggaaagcagtccttcagcgctcgtcccggtttctaaag
gaaagtgtcagtaccaggaggaagcagcaaggcattacgatgaagctggatgagttgaaa
aacttaacaagtcaatttcaggagagcatggataacattatgaagcaggccaacgactcc
cttgcgatgcttagagaaagccctggaggtatgagagagaagggcaggaaagccagagag
ctggcggcagcagccaacgagagtgcggtgaagacactggaggatgtgctggctttgagc
ctgagggtcttcaatacatcagaggacctgtccagagtgaatgccacagtccaggagaca
aacgaccttctgcataactccacgatgaccactctgttggctggaagaaaaatgaaagac
atggaaatgcaagccaaccttttattggatcgattgaaacctttgaaaaccctggaggag
aacctgagcagaaacctgtcggagatcaagctgctgatcagccgggcccggaaacaagtg
gcgtcgatcaaagtcgccgtgtctgcagacagagactgcatccgcgcctatcagcctcag
acttcatctaccaattacaacaccttgatcctgaacgtgaagacgcaggagcccgacaac
ctcctcttctacctcggcagcagcagcagttctgactttctcgcagtggagatgcggcgg
gggaaggtcgcctttctctgggacctgggctccgggtccacaaggttggaattcccagag
gtctccatcaataacaacagatggcacagcatctacataaccaggtttggaaacatgggg
tccctgagtgtaaaggaagcaagcgctgccgagaacccaccggtcaggacaagcaaatct
cctggaccgtcgaaggttctggacataaacaattcaacgctgatgtttgttggagggctc
ggaggtcagatcaagaaatccccggctgtgaaggttactcattttaagggctgcatggga
gaggccttcttgaatggcaaatcgattggcctgtggaattacatcgagagagaggggaag
tgcaatggctgctttggaagctcccagaacgaagattcctccttccatttcgatggaagc
gggtacgccatggtggagaagacgctccggcccaccgtgacgcagatagtaattctcttc
agcaccttctccccgaatggccttcttttctacctggcttcaaacggcaccaaggacttc
ctatccatcgagctggtccgtggcagggtcaaagtgatggtggacctagggtcaggaccc
ctcactcttatgacagacaggcggtataacaacggaacctggtataaaatcgccttccag
cggaaccggaagcaaggactgctagctgtcttcgatgcatatgacaccagtgacaaggag
acaaagcaaggagagactccaggagccgcttccgacctcaatcggctggagaaagacctg
atttacgtgggtggattgcctcattctaaggctgtgaggaaaggggtcagcagcagaagc
tatgtgggctgtatcaagaacctagagatatccaggtccacctttgatttgctgagaaat
tcctacggagtgagaaaaggctgcgcactggagcctatccagagtgtgagtttcctgaga
ggcggctatgtggagatgccacccaagtctctctcacctgagtcatccctgctggccaca
ttcgccaccaagaacagcagcggaatcctcctggttgccctgggcaaggatgcggaggag
gctggtggggctcaggcacatgtgcccttcttttccatcatgctgcttgagggacgaatt
gaagtgcatgtcaactctggggacgggaccagtctgaggaaggccctcctgcatgccccc
accggctcctacagtgatggacaggaacactccatctccctggttaggaatcggagagtt
atcaccatacaagtggatgagaacagtcccgtagaaatgaagttgggtccattaacagaa
ggaaagacgatcgacatatccaacctgtacatagggggacttccggaggacaaggcgacc
ccgatgctcaagatgcggacttcgttccatgggtgtattaaaaacgtggtccttgacgct
caacttttggacttcacccatgcgactggctctgagcaagtagagctggacacatgcttg
ctggcagaagagcccatgcagagtctgcacagagaacacggggaactccctccggagccc
ccaactctaccacagcctgaactgtgcgcagtagacacggctccggggtatgtggcaggt
gctcaccagtttggcctctcgcagaacagccacttggtgctccctctgaatcagtctgat
gtccggaagaggctccaggtgcagctgagcattcggacatttgcctccagtggcctcatt
tactatgtggctcatcagaaccaaatggactacgccacgctccagctccaagagggccgc
ctgcacttcatgtttgatctcggcaagggccggaccaaggtctcccaccctgccctgctc
agtgatggcaagtggcacacagtcaagacagaatacattaaaaggaaggcgttcatgact
gttgacggccaagagtcccccagtgtgactgtggtgggcaatgcaaccacgctggatgtg
gaaaggaaactgtacctcggaggccttcccagccactacagggccaggaacatcgggact
atcacccacagcatccctgcctgcattggggaaatcatggttaatggccaacagctggat
aaagacaggcccttgtctgcctctgctgtggacaggtgctatgtcgtggctcaggaagga
actttctttgaaggaagcggatatgcagctcttgtcaaggaaggttacaaagttcgattg
gatttaaatatcacactggagttccgtactacctctaagaatggcgtcctcctgggaatc
agcagtgccaaagtggatgccattggcctagagattgtagatggcaaggtcttatttcac
gtcaacaacggtgccggaaggataacagccacctaccagcccagagccgccagagctctc
tgtgatggcaagtggcacacactccaagcccacaaaagcaagcaccgcatcgtcctgact
gtggacgggaattccgttagggctgaaagcccccacacccattccacctcggcagacacc
aacgatcccatttatgtgggtggctatcctgcccacatcaaacagaactgcctgagcagc
cgggcctcattccggggctgtgtgaggaacctcaggctgagcaggggctcacaagtgcag
tccttggacctgagccgagcctttgacctacaaggagtcttccctcattcctgccccggg
cctgagccctaa

KEGG   Mus musculus (mouse): 16773
Entry
16773             CDS       T01002                                 

Gene name
Lama2, 5830440B04, dy, mKIAA4087, me, mer, merosin
Definition
(RefSeq) laminin, alpha 2
  KO
K05637  laminin, alpha 1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16773 (Lama2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16773 (Lama2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16773 (Lama2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16773 (Lama2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16773 (Lama2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16773 (Lama2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16773 (Lama2)
   05145 Toxoplasmosis
    16773 (Lama2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16773 (Lama2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16773 (Lama2)
   05414 Dilated cardiomyopathy
    16773 (Lama2)
   05416 Viral myocarditis
    16773 (Lama2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 DUF948 Arfaptin Ribosomal_S15
Other DBs
NCBI-GeneID: 16773
NCBI-ProteinID: NP_032507
MGI: 99912
Ensembl: ENSMUSG00000019899
Vega: OTTMUSG00000045038
UniProt: Q60675 Q5DTP0
Structure
PDB: 

Position
10 A4; 10 14.23 cM
AA seq 3118 aa
MPAATAGILLLLLLGTLEGSQTQRRQSQAHQQRGLFPAVLNLASNALITTNATCGEKGPE
MYCKLVEHVPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIKNGVEYHYV
TITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLYNIYP
RTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLR
FQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPATNK
SRCECEHNTCGESCDRCCPGFHQKPWRAGTFLTKSECEACNCHGKAEECYYDETVASRNL
SLNIHGKYIGGGVCINCTHNTAGINCETCVDGFFRPKGVSPNYPRPCQPCHCDPTGSLSE
VCVKDEKYAQRGLKPGSCHCKTGFGGVNCDRCVRGYHGYPDCQPCNCSGLGSTNEDPCVG
PCSCKENVEGEDCSRCKSGFFNLQEDNQKGCEECFCSGVSNRCQSSYWTYGNIQDMRGWY
LTDLSGRIRMAPQLDNPDSPQQISISNSEARKSLLDGYYWSAPPPYLGNRLPAVGGQLSF
TISYDLEEEEDDTEKILQLMIIFEGNDLRISTAYKEVYLEPSEEHIEEVSLKEEAFTIHG
TNLPVTRKDFMIVLTNLERVLMQITYNLGMDAIFRLSSVNLESAVPYPTDRRIATDVEVC
QCPPGYSGSSCETCWPRHRRVNGTIFGGICEPCQCFAHAEACDDITGECLNCKDHTGGPY
CNECLPGFYGDPTRGSPEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDECPIGYTGPRC
ERCAEGYFGQPSIPGGSCQPCQCNDNLDYSIPGSCDSLSGSCLICKPGTTGRYCELCADG
YFGDAVNAKNCQPCRCNINGSFSEICHTRTGQCECRPNVQGRHCDECKPETFGLQLGRGC
LPCNCNSFGSKSFDCEASGQCWCQPGVAGKKCDRCAHGYFNFQEGGCIACDCSHLGNNCD
PKTGQCICPPNTTGEKCSECLPNTWGHSIVTGCKVCNCSTVGSLASQCNVNTGQCSCHPK
FSGMKCSECSRGHWNYPLCTLCDCFLPGTDATTCDLETRKCSCSDQTGQCSCKVNVEGVH
CDRCRPGKFGLDAKNPLGCSSCYCFGVTSQCSEAKGLIRTWVTLSDEQTILPLVDEALQH
TTTKGIAFQKPEIVAKMDEVRQELHLEPFYWKLPQQFEGKKLMAYGGKLKYAIYFEARDE
TGFATYKPQVIIRGGTPTHARIITRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTV
TREDFLDILYDIHYILIKATYGNVVRQSRISEISMEVAEPGHVLAGSPPAHLIERCDCPP
GYSGLSCETCAPGFYRLRSEPGGRTPGPTLGTCVPCQCNGHSSQCDPETSVCQNCQHHTA
GDFCERCALGYYGIVRGLPNDCQPCACPLISPSNNFSPSCVLEGLEDYRCTACPRGYEGQ
YCERCAPGYTGSPSSPGGSCQECECDPYGSLPVPCDRVTGLCTCRPGATGRKCDGCEHWH
AREGAECVFCGDECTGLLLGDLARLEQMTMNINLTGPLPAPYKILYGLENTTQELKHLLS
PQRAPERLIQLAEGNVNTLVMETNELLTRATKVTADGEQTGQDAERTNSRAESLEEFIKG
LVQDAEAINEKAVQLNETLGNQDKTAERNLEELQKEIDRMLKELRSKDLQTQKEVAEDEL
VAAEGLLKRVNKLFGEPRAQNEDMEKDLQQKLAEYKNKLDDAWDLLREATDKTRDANRLS
AANQKNMTILETKKEAIEGSKRQIENTLKEGNDILDEANRLLGEINSVIDYVDDIKTKLP
PMSEELSDKIDDLAQEIKDRRLAEKVFQAESHAAQLNDSSAVLDGILDEAKNISFNATAA
FRAYSNIKDYIDEAEKVAREAKELAQGATKLATSPQGLLKEDAKGSLQKSFRILNEAKKL
ANDVKGNHNDLNDLKTRLETADLRNSGLLGALNDTMDKLSAITNDTAAKLQAVKEKAREA
NDTAKAVLAQVKDLHQNLDGLKQNYNKLADSVAKTNAVVKDPSKNKIIADAGTSVRNLEQ
EADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCVRTYRPEIKK
GSYNNIVVHVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTI
DDSYWYRIEASRTGRNGSISVRALDGPKASMVPSTYHSVSPPGYTILDVDANAMLFVGGL
TGKIKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFD
GEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELSDGHVKVSYDL
GSGMTSVVSNQNHNDGKWKAFTLSRIQKQANISIVDIDSNQEENVATSSSGNNFGLDLKA
DDKIYFGGLPTLRNLSMKARPEVNVKKYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLE
NVYTVSFPKPGFVELAAVSIDVGTEINLSFSTRNESGIILLGSGGTLTPPRRKRRQTTQA
YYAIFLNKGRLEVHLSSGTRTMRKIVIKPEPNLFHDGREHSVHVERTRGIFTVQIDEDRR
HMQNLTEEQPIEVKKLFVGGAPPEFQPSPLRNIPAFQGCVWNLVINSIPMDFAQPIAFKN
ADIGRCTYQKPREDESEAVPAEVIVQPQPVPTPAFPFPAPTMVHGPCVAESEPALLTGSK
QFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNGFPY
FSYDLGSGDTSTMIPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGI
LYVGGLPINYTTRRIGPVTYSLDGCVRNLHMEQAPVDLDQPTSSFHVGTCFANAESGTYF
DGTGFAKAVGGFKVGLDLLVEFEFRTTRPTGVLLGVSSQKMDGMGIEMIDEKLMFHVDNG
AGRFTAIYDAGIPGHMCNGQWHKVTAKKIKNRLELVVDGNQVDAQSPNSASTSADTNDPV
FVGGFPGGLNQFGLTTNIRFRGCIRSLKLTKGTGKPLEVNFAKALELRGVQPVSCPTT
NT seq 9357 nt   +upstreamnt  +downstreamnt
atgcctgcggccaccgccgggatcctcttgctcctgctcttggggacgctcgaaggctcc
cagactcagcggcgacagtcccaagcgcatcaacagagaggtttatttcctgctgtcctg
aatcttgcttcgaatgcactcatcacaaccaatgctacatgtggggaaaaaggacccgag
atgtactgcaagttggtggaacatgtccccgggcagcctgtgaggaaccctcagtgccga
atctgcaatcagaacagcagcaatccataccagaggcacccgattacgaatgctattgat
ggcaagaacacatggtggcagagtcccagtatcaagaatggagtggaataccattatgtg
acaattactctggatttacagcaggtgttccagattgcctacgtaattgtgaaggcagcc
aattcccctcggcctggaaactggattttggaacgttccctggatgacgtggagtacaaa
ccctggcagtatcatgcggtgacagacacggagtgcctgaccctctacaatatctatccc
cgcactggaccaccatcctacgccaaagatgatgaggtcatctgcacttcattttattcg
aagatccaccctttagaaaatggagagattcacatttctttgatcaatgggagaccaagt
gctgatgacccctcccctgaactcctggaattcacctctgctcgctacattcgcctgaga
tttcagaggatccgcaccttgaatgcagacttgatgatgtttgctcacaaagaccccaga
gaaatcgatcccattgtcacacgaagatattactattctgtcaaggatatttcagttggc
gggatgtgcatctgttatggtcatgcccgggcttgtccacttgaccctgcaacaaataaa
tcacgctgtgagtgtgaacataacacctgtggggaaagctgtgacaggtgctgtccagga
ttccatcagaagccttggagagctggaaccttcctcaccaagtctgagtgtgaagcatgc
aattgtcacggaaaagctgaggaatgctattatgatgaaactgttgctagcagaaatcta
agtttaaatatacatgggaagtacatcggagggggtgtgtgcatcaactgcacacataac
acggctgggataaattgtgagacatgtgttgatggattcttcagaccaaaaggggtatca
ccaaattatccaagaccatgccagccatgtcactgtgatccaactggctcccttagtgaa
gtctgtgtcaaagatgagaaatatgcccagcgagggttgaaacctggatcctgtcactgc
aaaactggctttggaggcgtgaactgtgatcgctgtgtcaggggttaccatggttaccca
gactgccaaccctgtaactgtagtggcttggggagcacaaacgaggacccttgcgttggg
ccctgtagctgtaaggagaatgttgaaggtgaagactgtagtcgttgcaaatctggtttc
ttcaacttgcaagaagataatcagaaaggctgtgaggagtgtttctgttcaggagtatca
aacagatgtcagagttcctactggacctatgggaatattcaagacatgcgtggttggtat
ctcacagacctctctggccgcattcggatggctccccagcttgataaccctgactcacct
cagcagatcagcatcagtaactctgaggcccggaaatccctgcttgatggttactactgg
agtgcaccgcctccatatctgggaaacagacttccagctgttggaggacagttgtcattt
accatctcatatgacctcgaagaagaggaagacgatacagaaaaaatccttcagctgatg
attatctttgagggaaatgacttaagaatcagcacagcgtataaggaggtgtacttagag
ccatctgaagaacacattgaggaggtgtcactcaaagaagaggcctttactatacatgga
acaaatttgccagtcactagaaaagatttcatgattgttctcacaaatttggagagagtc
cttatgcaaatcacatacaacttagggatggacgccatcttcaggctgagttctgtcaat
cttgaatctgctgtcccttatcctactgatagacgtattgcaactgatgtggaagtttgc
cagtgtccacctgggtacagtggcagctcttgtgaaacatgttggcctaggcaccgaaga
gttaacggcaccatttttggtggcatttgtgaaccatgtcagtgctttgctcatgcagaa
gcctgtgatgacatcacaggagaatgtctgaactgtaaggatcacacaggtgggccgtac
tgcaatgaatgtctccctggtttctatggtgatcctactcgaggaagccctgaagactgt
cagccctgtgcctgtccactcaatatcccatcaaataactttagtccaacatgccattta
gaccggagtctgggattgatctgtgacgagtgtcctattgggtacacaggaccgcgctgt
gagaggtgtgcagaaggctattttggacaaccttccatacctggaggatcatgtcagcca
tgccaatgcaatgacaaccttgactactccatccctggcagctgtgacagcctgtctggc
tcctgtctgatttgtaagccaggtacaacaggccggtactgtgagctctgtgctgatggg
tattttggagacgcggttaatgcaaagaactgtcaaccatgccgttgtaatatcaatggc
tccttctcagagatttgtcacactagaactgggcaatgtgagtgcagacccaatgtgcag
gggcggcactgtgacgagtgtaagcctgaaacctttggcctgcaactgggaaggggttgt
ctgccctgcaactgcaattcttttgggtctaagtcctttgactgtgaagcaagtgggcag
tgctggtgccagcctggagtagcagggaagaaatgtgaccgttgtgcccatggctacttc
aacttccaagaaggaggctgcatagcttgtgactgttctcatctgggcaacaactgtgac
ccaaaaactggccaatgcatttgcccacccaataccactggagaaaagtgttctgagtgt
cttcccaacacctggggtcacagcattgtcaccggctgtaaggtttgtaactgcagcact
gtggggtccttggcttctcagtgcaatgtaaacacgggccagtgcagctgtcatccaaaa
ttctctggtatgaaatgctcagagtgcagccgaggtcactggaactatcctctctgcact
ctatgtgactgcttccttccagggacagatgccacgacttgtgatctggagactaggaaa
tgctcctgtagtgatcaaactggacagtgcagctgtaaggtgaatgtggaaggcgtccac
tgtgacaggtgccggcctggcaaatttggactagatgccaagaacccacttggctgcagc
agctgctactgctttggagttactagtcaatgctctgaagcaaaggggctgatccgtacg
tgggtgactttgagtgatgaacagaccattctacctctggtggatgaggccctgcagcac
acgactaccaaaggcattgctttccagaaaccagagattgttgcaaagatggatgaagtc
aggcaagagctccatttggaacctttttactggaaactcccacaacaatttgaagggaaa
aagttgatggcttatggtggcaaactcaagtatgccatctattttgaggctcgggatgag
acaggctttgccacatataaacctcaagttatcattcgaggtggaactcctactcatgct
agaattattaccagacacatggctgcccctctcattggccagttgacacggcatgaaata
gaaatgacagagaaagaatggaaatattatggtgatgatcctcgaatcagtagaactgtg
acccgtgaagacttcttggatatactatatgatattcactatatccttatcaaggctact
tatggaaacgttgtgagacaaagccgcatttctgaaatctccatggaagtagccgaacca
ggacatgtattagcagggagcccaccagcacacttgatagaaagatgcgattgccctcct
ggctattctggcttgtcttgtgagacgtgtgcaccaggattttatcgacttcgttctgaa
ccaggtggccgcactcctggaccaaccttaggaacctgtgttccctgccaatgtaatgga
cacagcagtcagtgtgatcctgagacctcagtatgccagaattgtcagcatcacactgct
ggtgacttctgtgagcgctgtgcccttggctactatggaatcgtcaggggattgccaaat
gactgtcaaccatgtgcttgtcctctgatttcgcccagcaacaatttcagcccctcttgt
gtattggaaggtctggaagattaccgttgcaccgcctgcccaaggggctatgaaggacag
tactgtgaaaggtgtgccccaggctatactggcagcccaagcagccccggaggctcctgc
caagaatgtgagtgtgacccttatggctccctaccggttccctgtgaccgggtcacggga
ctctgcacgtgccgccctggagccacaggaaggaagtgtgatggctgcgagcactggcat
gcacgcgagggtgcagagtgtgtcttttgtggagacgagtgtacaggccttcttcttggt
gacctggctcgtctagagcagatgaccatgaacatcaacctcacgggcccactgcctgct
ccatataaaattctgtatggtcttgaaaatacaactcaggaactcaagcacctgctatca
ccgcaacgggcaccagagaggctcattcagttggcagagggcaacgtgaacacacttgtg
atggaaacaaatgagctgctaaccagagcaaccaaagtgacagcagatggtgagcaaaca
ggacaagatgctgagaggaccaactccagagcagaatccttggaagaattcattaaaggg
cttgtccaggatgctgaagccataaatgaaaaagctgtacaactaaatgaaaccttagga
aatcaagataagacagcagagagaaacttggaggagcttcaaaaggaaatcgaccggatg
ctgaaggaactgagaagtaaagatcttcaaacacagaaggaagttgctgaggatgagctc
gtggcagcagaaggccttctgaagagagtaaacaagctgtttggagagcccagagcccag
aatgaagatatggaaaaggatctccagcagaaactggcagagtacaagaacaaacttgat
gatgcttgggatctattgagagaagccactgataaaactcgagatgctaatcgtttgtct
gctgccaatcaaaaaaacatgaccatactggagacaaagaaggaggctattgaaggtagc
aaacgacaaatagagaacactttaaaggaaggcaatgacatccttgatgaagccaatcga
ctcttaggtgaaatcaactcagtcatagattatgtcgacgacattaaaactaagttgcca
ccaatgtccgaggagctgagtgacaaaatagatgacctcgcccaggaaataaaggacaga
aggcttgctgagaaggtgttccaggctgagagccatgctgctcagctgaacgactcgtct
gctgtacttgatggaatcctggatgaggctaagaacatctctttcaatgccacggcagcc
ttcagagcttacagtaatattaaagactacattgatgaagctgagaaagtggccagagaa
gccaaagagcttgcccaaggggctacaaaactggcaacaagtcctcagggcttattaaaa
gaagatgccaaaggctcccttcagaaaagcttcaggatcctcaatgaagccaagaagcta
gcaaacgatgtgaaaggaaatcacaatgatctaaatgacctgaaaaccaggttagaaact
gctgaccttagaaacagtggacttctaggagctctaaatgacaccatggacaagttatca
gccattacaaatgacacggctgctaaactgcaggctgtcaaagagaaagccagagaagcc
aatgacacagcaaaagctgtcctggcccaggttaaggacctgcatcagaacctagatggc
ctgaagcaaaactacaataaactggcagacagcgtggccaaaacgaacgctgtggtgaaa
gatccttccaaaaacaaaatcattgcagatgcaggcacttccgtgagaaatctagaacag
gaagctgaccggctaatcgacaaactcaagcccatcaaggagcttgaggacaacctaaag
aaaaacatttctgaaataaaggaactgatcaaccaagctcggaaacaagctaactctatc
aaagtatctgtttcttcgggaggtgactgtgttcgaacatacaggccagaaatcaagaaa
ggaagctacaataacatcgttgtccatgtcaagaccgctgttgccgacaacctccttttt
tatcttggaagtgccaaatttattgactttcttgctatagaaatgcgcaaaggcaaagtc
agcttcctctgggatgttggctctggagttggccgagtagagtatccagacttgaccatc
gacgactcctattggtaccgtattgaagcatcaagaacgggaagaaatggatctatttct
gtgagagctttagatggacccaaagccagtatggtacccagcacctaccattcagtgtct
cctcccgggtacactatcctagatgtggatgcaaatgcaatgctgtttgttggtggcctg
accggaaaaataaagaaggccgatgctgtacgtgtgatcaccttcaccggctgtatggga
gaaacatactttgacaacaaacctataggtttatggaacttccgggagaaagaaggcgac
tgtaagggatgtactgtcagcccacaagtggaagatagtgaggggactattcagtttgat
ggtgaaggctatgcattagtgagccgccctatccgctggtaccccaacatctccacagtc
atgttcaagttccggacattttcatcaagtgctctcctgatgtatcttgccacacgagac
ctgaaagatttcatgagtgtagagctcagtgatggacatgtgaaagtcagctatgacctg
ggctcaggaatgacttccgttgtcagcaatcaaaaccataatgatgggaaatggaaagca
ttcacgctgtcgcggattcagaaacaagccaacatatcgattgtcgacatcgattctaac
caggaggagaatgtagctacttcatcttctggaaacaactttggtcttgacttgaaagca
gatgacaaaatatattttggtggcctgccaactctgagaaacttgagtatgaaagcaagg
ccagaagtcaatgtgaagaaatactccggctgcctcaaagatattgaaatttcaagaaca
ccttacaatatactcagcagccctgattatgttggtgtgaccaaaggctgttcactggag
aatgtttatacagttagtttccccaagcctggttttgtggagcttgccgctgtgtctatt
gatgttggaacagaaatcaatctgtcctttagtaccaggaacgagtctgggatcattctc
ttgggaagtggagggacactcacaccacccaggagaaaacggagacaaaccacacaggct
tattatgccatattcctcaacaagggccgcttggaagtgcatctctcctcggggacacgg
acaatgaggaaaattgtcatcaaaccggagccaaatttgtttcatgatgggagagaacat
tctgtccacgtagaaagaaccagaggcatcttcactgttcaaattgatgaagacagaaga
catatgcaaaacctgacagaggaacagcccatcgaagtgaaaaagctctttgtcgggggt
gctcctcctgaatttcagccctccccactcaggaatattccggcctttcaaggctgtgtg
tggaaccttgttattaactccatccccatggactttgcgcagcctatagccttcaaaaat
gccgacattggccgctgtacctatcaaaagccccgggaagatgagagtgaagcagttcca
gctgaagttattgtccagcctcagccggtgcccacccctgccttccctttcccggccccc
accatggtgcatggcccttgtgttgcagaatcagaaccagctcttctgacagggagcaag
cagtttgggctttccagaaacagccacattgcaattgcttttgatgacaccaaagttaaa
aatcgcctcaccattgagctggaggtacgaactgaagctgaatcaggcttgctcttctac
atggctcggatcaatcatgctgattttgctactgttcagctgaggaatggcttcccgtac
ttcagttatgatttggggagtggggacacaagcaccatgatccccacaaaaatcaacgat
ggccagtggcacaagattaagattgtgagagtgaagcaggagggaattctttatgtggat
gatgcctccagccaaaccatcagtcccaagaaagctgacatcctggatgtcgtggggatt
ctgtatgtcggtggattgccgatcaactataccacacgcagaattggtccagtgacttac
agcctggatggctgtgttaggaatcttcacatggaacaagcccctgttgatctggaccag
cctacctccagctttcacgttgggacatgctttgcgaatgcagagagtgggacttacttt
gatggaaccggttttgctaaagcagttggtgggttcaaagttggattggaccttcttgtg
gaatttgaattccgtaccacaagacccactggggtcctcctgggagtcagcagtcagaag
atggatggaatgggtattgaaatgatcgacgagaagcttatgttccacgtggataatggc
gctggccgattcactgcaatctatgatgctgggatcccaggccacatgtgcaatggacag
tggcataaagtcactgccaagaagatcaaaaaccgtcttgagctggtggtagatgggaac
caggtggatgcccagagcccaaactcagcatcgacatcagctgatacaaacgaccctgtt
tttgttggcggtttcccaggtggcctcaatcagtttggcctgaccaccaacattaggttc
cgaggctgcatccgatctctgaagctcaccaaaggcactggcaaaccgctggaggttaat
tttgccaaggccctggaactgaggggtgttcaacctgtatcatgcccgactacctaa

KEGG   Mus musculus (mouse): 16774
Entry
16774             CDS       T01002                                 

Gene name
Lama3, Lama3B, [a]3, [a]3B
Definition
(RefSeq) laminin, alpha 3
  KO
K06240  laminin, alpha 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16774 (Lama3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16774 (Lama3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16774 (Lama3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16774 (Lama3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16774 (Lama3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16774 (Lama3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16774 (Lama3)
   05145 Toxoplasmosis
    16774 (Lama3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_I Laminin_G_2 Laminin_N Laminin_G_1 Laminin_II Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 16774
NCBI-ProteinID: NP_034810
MGI: 99909
Ensembl: ENSMUSG00000024421
Vega: OTTMUSG00000045059
UniProt: Q61789
Position
18 A1; 18 6.2 cM
AA seq 3330 aa
MAVALGRAPRSLPLLLTLLLLLLLRMSPSWSVVGQDHPMSSRSLHPPYFNLAQAARIWAT
ATCGERDPEVSRPRPELFCKLVGGPAAQGSGHTIQGQFCDYCNSEDSRKAHPASHAIDGS
ERWWQSPPLSSGTQYNQVNLTLDLGQLFHVAYILIKFANSPRPDLWILERSVDFGSTYSP
WQYFAHSRRDCVEQFGQEANMAITQDDQMLCVTEYSRIVPLENGEIVVSLINGRPGAKKF
AFSDTLREFTKATNIRLRFLRTNTLLGHLISKAERDPTVTRRYYYSIKDISVGGRCVCNG
HAEACSADNPEKQFRCECQHHTCGDTCNRCCAGYNQRRWQPAGQEQHNECEACNCHGHAV
DCYYDPDVEHQQASLNSKGVYAGGGVCINCQHNTAGVNCEKCAKGYFRPHGVPVDALHGC
IPCSCDPERADDCDQGSGHCHCKPNFSGDYCETCADGYYNFPFCLRIPVFPNYTPSPEDP
VAGNIKGCDCNLEGVLPEICDDRGRCLCRPGVEGPQCDSCRSGSYSFPICQACQCSTIGS
YPVPCDPGNGQCDCLPGITGRQCDRCLSGAYDFPYCQGSGSVCHPAGTLDSSLGYCQCKQ
HVASPTCSVCKPLYWNLAKENPRGCSECQCHEAGTLSGIGECGQEDGDCSCKAHVTGDAC
DTCEDGFFSLEKSNYFGCQGCQCDIGGALTTMCSGPSGVCQCREHVEGKQCQRPENNYYF
PDLHHMKYEVEDGTGPNGRNLRFGFDPLVFPEFSWRGYAPMTSVQNEVRVRLSVRQSSLS
LFRIVLRYISPGTEAISGRITLYSSQGDSDALQSRKITFPPSKEPAFVTVPGNGFAGPFS
ITPGTWIACIQVEGVLLDYLVLLPRDYYEAFTLQVPVTEPCAHTGSPQDNCLLYQHLPLT
AFSCTLACEARHFLLDGELRPLAMRQPTPTHPAMVDLSGREVELQLRLRVPQVGHYVVLL
EYATEVEQLFVVDVNLKSSGSALAGQVNIYSCKYSIPCRSVVIDSLSRTAVHELLADADI
QLKAHMAHFLLYHICIIPAEEFSTEYLRPQVHCIASYRQHANPSASCVSLAHETPPTASI
LDATSRGLFSALPHEPSSPADGVTLKAPQSQVTLKGLIPHLGRHVFVIHFYQAEHPGFPT
EVIVNGGRQWSGSFLASFCPHLLGCRDQVISDGQVEFDISEAEVAVTVKIPDGKSLTLVR
VLVVPAENYDYQILHKTTVDKSSEFISSCGGDSFYIDPQAASGFCKNSARSLVAFYHNGA
IPCECDPAGTAGHHCSPEGGQCPCRPNVIGRQCSRCATGYYGFPYCKPCNCGRRLCEEVT
GKCLCPPHTVRPQCEVCEMNSFNFHPVAGCDVCNCSRKGTIEAAVSECDRDSGQCRCKPR
VTGQQCDKCAPGFYQFPECVPCSCNRDGTEPSVCDPETGACMCKENVEGPQCQLCREGSF
YLDPTNPKGCTKCFCFGVNTDCQSSHKQRAKFVDMMGWRLETADGVDVPVSFNPGSNSMV
ADLQELPPSVHSASWVAPPSYLGDKVSSYGGYLTYHAKSFGLPGDMVLLGKQPDVQLTGQ
HMSLIHKEPSDPRPDRLHHGRVQVIEGNFRHEGSSAPVSREELMTVLSRLERLHIRGLHF
TETQRLTLGEVGLEEASDTGSGPRAHLVEMCACPPDYTGDSCQGCRPGYYWDNKSLPVGR
CVPCNCNGHSNRCQDGSGICINCQHNTAGEHCERCQAGHYGNAIHGSCRVCPCPHTNSFA
TGCAVDGGAVRCACKPGYTGTQCERCAPGYFGNPQKFGGSCQPCNCNSNGQLGPCDPLTG
DCVNQEPKDGSPAEECDDCDSCVMTLLNDLASMGEELRLVKSKLQGLSVSTGALEQIRHM
ETQAKDLRNQLLGFRSATSSHGSKMDDLEKELSHLNREFETLQEKAQVNSRKAQTLYNNI
DQTIQSAKELDMKIKNIVQNVHILLKQMARPGGEGTDLPVGDWSRELAEAQRMMRDLRSR
DFKKHLQEAEAEKMEAQLLLHRIRTWLESHQVENNGLLKNIRDSLNDYEDKLQDLRSILQ
EAAAQAKQATGINHENEGVLGAIQRQMKEMDSLKNDFTKYLATADSSLLQTNNLLQQMDK
SQKEYESLAAALNGARQELSDRVRELSRSGGKAPLVVEAEKHAQSLQELAKQLEEIKRNT
SGDELVRCAVDAATAYENILNAIRAAEDAASKATSASKSAFQTVIKEDLPKRAKTLSSDS
EELLNEAKMTQKRLQQVSPALNSLQQTLKTVSVQKDLLDANLTVARDDLHGIQRGDIDSV
VIGAKSMVREANGITSEVLDGLNPIQTDLGRIKDSYESARREDFSKALVDANNSVKKLTR
KLPDLFIKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAIPMRFNGKSGVEVRLP
NDLEDLKGYTSLSLFLQRPDLRENGGTEDMFVMYLGNKDASKDYIGMAVVDGQLTCVYNL
GDREAEVQIDQVLTESESQEAVMDRVKFQRIYQFAKLNYTKEATSTKPKAPGVYDMESAS
SNTLLNLDPENAVFYVGGYPPGFELPRRLRFPPYKGCIELDDLNENVLSLYNFKTTFNLN
TTEVEPCRRRKEESDKNYFEGTGYARIPTQPNAPFPNFMQTIQTTVDRGLLFFAENQDNF
ISLNIEDGNLMVKYKLNSEPPKEKGIRDTINNGRDHMILISIGKSQKRMLINMNKHSIII
EGEIFDFSTYYLGGIPIAIRERFNISTPAFQGCMKNLKKTSGVVRLNDTVGVTKKCSEDW
KLVRTASFSRGGQMSFTNLDVPSLDRFQLSFGFQTFQPSGTLLNHQTRTSSLLVTLEDGH
IALSTRDSSSPIFKSPGTYMDGLLHHVSVISDTSGLRLLIDDQVLRRNQRLASFSNAQQS
LSMGGGYFEGCISNVFVQRMSQSPEVLDMASKSTKRDAFLGGCSLNKPPFLMLFKSPKGF
NKARSFNVNQLLQDAPQAARSIEAWQDGKSCLPPLNTKATHRALQFGDSPTSHLLFKLPQ
ELLKPRLQFSLDIQTTSSRGLVFHTGTRDSFVALYLSEGHVIFALGAGGKKLRLRSKERY
HDGKWHSVVFGLSGRKVHLVVDGLRAQEGSLPGNSTISPREQVYLGLSPSRKSKSLPQHS
FVGCLRNFQLDSKPLDSPSARSGVSPCLGGSLEKGIYFSQGGGHVVLANSVSLEPALTLT
LSIRPRSLTGVLIHIASQSGEHLSVYMEAGKVTTSMNSEAGGTVTSITPKRSLCDGQWHS
VTVSIKQHTLHLELDTDNSYTAGQLSFPPNSTRGSLHIGGVPDKLKMLTLPVWNSFFGCL
KNIQVNHIPVPITEATDVQGSVSLNGCPDH
NT seq 9993 nt   +upstreamnt  +downstreamnt
atggcggtggctctgggcagggcaccgcgatccttaccgctgctgctcactctattgctg
ctgctgttgctgaggatgtcgcccagctggagcgtggtgggtcaggaccatcccatgtcc
tcgcgcagcctgcacccgccctacttcaacctggcccaggcggcgagaatctgggccacc
gccacctgcggggagcgggacccagaggtctcaaggccccggcctgagcttttctgcaaa
ttggtgggcggccccgctgcacagggcagcggccacaccatccagggccagttctgtgac
tactgcaattctgaggattccaggaaggcacatccagccagccatgcaattgatggatcg
gaacggtggtggcaaagcccacctctctcctccggcacacagtacaatcaagtcaacctc
accttggatctgggtcagctcttccatgtggcttatatcttaatcaaatttgcaaactct
ccccgccctgatctttggatcctggaaagatctgtagactttggaagcacctactcacca
tggcagtattttgctcattctagaagagattgtgtagaacagtttgggcaagaagcaaac
atggcaattacccaggacgaccagatgctctgtgtcacggagtattcccgtatcgtgcct
ctggaaaatggcgagattgttgtatccttgataaatggtcgtccaggtgcaaaaaagttt
gctttctctgacactctgagggagtttactaaggcaacaaacatccgcttgcggtttctg
cgaaccaacaccctcctcgggcatcttatttccaaggcagagcgagaccccactgtcacg
cgccggtattattacagcataaaggatatcagtgttggtgggcggtgtgtttgcaacggc
catgcggaggcgtgcagtgctgacaaccctgaaaagcagttccgatgcgaatgccagcac
catacctgtggagacacgtgtaaccgctgctgtgcaggttacaatcagaggcgctggcag
cctgctggtcaggagcagcacaatgagtgtgaagcctgcaactgccatgggcatgctgtg
gactgctactatgacccagacgtggagcaccagcaggcgagcttgaacagcaaaggcgtc
tacgcaggtggaggggtctgcatcaactgtcagcacaacactgcaggcgtgaactgtgaa
aagtgtgcgaagggttacttccggccccatggagttccggtggatgcactgcatggatgc
atcccttgcagctgtgacccagaacgcgcagatgactgtgaccagggctcaggccactgc
cattgtaagccaaatttctccggagactactgtgagacgtgtgcagatgggtactataat
tttccattttgcttgagaattccagtctttcccaactacactccaagtccagaagatcca
gtggctggcaatataaaagggtgtgactgtaacttggaaggtgttctcccagagatatgt
gacgatcgtggcaggtgcctgtgccgccctggggttgagggtccccagtgtgactcctgc
cgctcgggctcctattcatttcccatatgccaagcttgccagtgttcgacgattggatcc
tatccagtgccctgtgacccggggaatggccagtgtgactgcctgcctggaattaccggg
aggcagtgtgacaggtgtctctcgggagcctatgactttccatactgccaagggtccggc
agtgtttgccatccagctgggacccttgactccagcctgggttattgtcagtgcaagcag
catgttgcaagtcctacatgtagtgtctgcaaaccattatattggaatctggccaaagaa
aacccccgtggatgctcagagtgccagtgccatgaagcagggacattgagtggaattgga
gagtgtgggcaggaggacggtgactgtagctgcaaagcccatgtaactggtgatgcctgc
gacacctgtgaagatgggtttttctctttggagaagagcaattactttggctgtcaaggg
tgtcagtgtgacattggtggagcactcaccaccatgtgtagtgggccctcgggagtatgc
cagtgcagagagcacgtggaggggaaacagtgccagaggcctgaaaataactactacttc
ccggatttgcaccacatgaagtatgaggtcgaagatggcactggacctaatggaagaaac
ctgcggtttggatttgatcccctggtattccctgagtttagctggagaggatatgctcca
atgacctcagtccagaatgaagtaagggtgagattgtctgtgaggcagtccagcctctcc
ttgttccgcatcgttctgagatacatcagtcctggaacggaagccatatccggccgaatc
actctttactcatcgcagggagattcggatgctttgcaaagcagaaaaatcacctttccc
ccgagtaaagagccagcctttgtcacagtccctgggaatggctttgcaggcccattctcc
atcacacctgggacgtggattgcttgcatccaggtggaaggagtccttctggactacctg
gtgctgcttcccagggactactatgaagcattcaccctgcaagtgccagtcacagagcca
tgtgcccacacaggatctccccaggacaactgtttgctttaccagcatttaccactgact
gcattctcctgtaccctggcttgtgaggccagacacttcctgctggatggagagctgaga
cccttggcaatgaggcagcccacacccacacacccagccatggtggacctcagcgggaga
gaggtagaactgcagcttcgtctgcgggtcccacaggttggccactacgtggtcctgctg
gagtatgccacggaggtggagcagctttttgtggtggacgtgaatctgaagagctcaggg
tctgccttggcaggccaggtgaacatatacagctgcaagtacagcatcccgtgcaggagt
gtggtgattgacagcctgagtcgcacggctgtacatgagctgttggcagatgcagacatt
cagctcaaggcgcacatggcccatttccttttgtatcacatttgtattataccagctgaa
gaattctcaactgaatatttgagacctcaagtccactgcattgccagctacaggcagcat
gctaatccaagtgcttcctgtgtctccctggcccatgaaactcctccaacagcctcaatt
ttggatgctacaagtaggggccttttctctgccctacctcatgagccttcctctcctgca
gatggagttactctgaaggcaccacagagtcaagtgaccctgaaaggactcataccacac
ctgggccgacacgtctttgtcatccatttttatcaagcagagcacccagggtttcccact
gaggtgattgtgaatggaggaagacagtggtcaggttccttccttgcctccttctgtccc
cacttacttggctgccgggaccaggtgatctctgatggccaagtggagtttgacatctct
gaagcagaggtagctgtgacagtgaagattccagatggaaagtccttaacattggtccgg
gttctagtggtacctgcagagaattacgactaccaaattcttcacaaaacaacagtggac
aagtcctccgagttcatcagcagttgtggaggagacagcttttatattgatccccaggca
gcctctggattctgtaagaattctgcaaggtccctggtagccttttaccataacggtgcc
ataccctgtgagtgcgaccctgctgggactgccggccaccactgtagtcctgagggtggg
cagtgcccttgccggcccaatgtcatcgggaggcagtgcagccgctgtgcgacaggctac
tatggattcccatactgcaagccttgtaattgtggcagacgcctttgtgaagaggtgaca
gggaagtgtctctgcccaccccacacagtcaggcctcagtgtgaggtctgtgagatgaat
tccttcaactttcaccctgtggctggctgtgacgtctgcaactgctccaggaagggcacc
attgaggcggccgtctctgagtgtgacagggacagcgggcagtgcaggtgcaagcctaga
gtcacagggcagcagtgtgacaagtgtgctcctggcttctaccagttccctgagtgtgtc
ccctgcagctgtaacagagatgggactgagcccagcgtatgtgacccagagactggggct
tgcatgtgcaaggaaaatgtagagggcccccaatgtcaactgtgtcgagaaggatcattc
tacctggacccaacaaacccaaagggttgtaccaagtgcttctgttttggagtgaatact
gactgtcagagttcgcataagcaacgagctaagtttgtagacatgatgggctggcgtctg
gagacagcagatggagttgatgtccctgtgtccttcaaccctggcagcaacagcatggtg
gcagatctgcaggagctgccaccctcagttcacagtgcatcctgggtggcacctccatcc
tacctaggtgataaggtatcatcgtacggcggctacctcacctaccacgccaagtccttt
ggcttacctggagatatggttcttctgggaaagcagccagatgtgcagctcactggtcaa
cacatgtccctcatccataaggaacccagcgacccacggccagacaggctgcatcacgga
agagtgcaagtgattgagggaaacttcagacacgaaggcagcagtgccccagtgtcccgg
gaggagctgatgactgtgctgtccagactggaaagactccacatccggggcctccatttc
accgagacacagcggctcaccttgggtgaggtagggctggaggaggcctctgacacggga
agcggacccagggctcatcttgtggagatgtgtgcctgcccccctgactacacaggtgac
tcatgccagggttgtcgccctggatactattgggacaacaaaagcttacctgtaggaagg
tgtgttccctgcaattgcaacggacattcaaatagatgccaggatggctccgggatatgc
attaactgtcagcacaacacagctggggagcactgtgagcgttgccaagcaggtcactat
ggaaatgccatccacggatcttgtagggtctgcccctgccctcataccaacagttttgcc
accggctgtgctgtggatggtggagctgtgaggtgtgcctgcaaacccggatacacagga
acacagtgtgagaggtgtgcaccaggatattttgggaacccccagaaatttggaggtagc
tgccagccatgcaattgtaacagcaatggccagttaggtccttgcgaccccctaactgga
gactgtgtaaaccaagaacccaaagatggcagccctgcagaagaatgtgatgactgcgac
agctgtgtgatgacgctcttaaatgacttggcctccatgggtgaggaactccgcctggtg
aagtcaaagctgcaggggctgagtgtgagcacgggtgctctggaacagatccggcacatg
gagacgcaggccaaggacctgaggaaccagctgcttggcttccgttctgccacctcaagt
catgggtccaaaatggatgacctggaaaaagagctgagtcatttgaaccgggaatttgaa
actctgcaagaaaaggcacaggtcaattccagaaaagcacaaacattatataacaacatt
gatcagacaatccaaagtgccaaagaactggacatgaagattaaaaacatcgttcagaat
gtgcacattctcctgaagcagatggcgaggccaggtggagaaggcacggacttgccagtg
ggtgactggtccagggagctggccgaagctcaacgcatgatgcgagacctgcgaagccga
gactttaaaaagcacctccaagaagcagaggccgagaaaatggaagcccagctcttactg
caccggatcaggacctggctggaatcccaccaggtggagaacaacggactgctaaagaat
attcgggactccttaaatgattatgaagacaaacttcaggacctacgttccatcctccag
gaggcagctgcccaggcaaagcaggccactggcatcaaccatgaaaatgagggggttctc
ggagccatccagagacaaatgaaagaaatggattccctgaagaatgacttcaccaagtac
ctggccacagccgactcttccctgctgcagaccaacaatctactgcagcagatggacaaa
agccagaaggaatatgaaagcttagctgctgctttaaatggagcaagacaggaactgagt
gacagagtgcgagaactgtccagatcgggtggcaaagcaccgctggtggtggaggcagag
aagcatgcacagtctttacaggagctggcaaagcagctggaagagataaagagaaacacc
agcggggatgagctggtgcgttgtgctgtggatgctgccacggcctatgagaacatcctc
aatgccatcagagcagcagaggatgcagccagcaaggccaccagtgcctccaagtctgcc
ttccaaacagtgataaaggaagaccttccaaaaagagctaagaccctgagttctgacagc
gaggaactgttaaatgaagccaagatgacacagaaaaggctacagcaagtcagtccagct
ctcaacagcctacaacaaaccctgaagactgtatcagttcagaaggacctgctagatgcc
aacctcactgttgcccgtgatgatcttcatgggatacagagaggtgatatcgacagtgtg
gtgatcggtgcaaagagcatggtcagggaagccaacggaataacaagcgaggtcctggac
gggctcaaccccatccagacagatttgggaaggattaaggacagctatgagagcgcacgg
cgtgaagacttcagcaaggctctggtcgatgccaataactcagtaaagaaattaaccagg
aagttgcctgatctttttatcaagattgaaagtatcaaccaacagttgctgcccctgggg
aacatctctgacaatgtggaccgaatccgagaactcattcagcaggccagagatgctgca
aacaaggttgcaattcccatgaggttcaatggtaaatctggtgtcgaagtccgactgccg
aatgacctagaagatttaaaaggatacacatctctgtctttgtttctccaaagacctgac
ttgcgagagaacggaggcactgaggatatgtttgtaatgtaccttgggaataaggatgcc
tccaaggactacattggcatggcggttgtagatggccagctgacatgtgtgtacaacctg
ggggaccgagaggctgaagttcagatagaccaggtcctgacggagagtgagtctcaggag
gcagttatggaccgggtgaagttccagaggatatatcaatttgccaagcttaattacacc
aaagaagccacatctactaaacccaaagcccctggggtctatgacatggagagcgccagt
agcaacacactccttaatttggatcctgagaatgcagtattttacgtcggcggttatcca
cctggttttgagcttccacgcagactgcggttccctccatacaaaggctgtatcgaacta
gatgacctcaacgaaaacgttctaagcttgtacaatttcaagacaactttcaatctcaat
accactgaagtagagccttgtaggaggagaaaggaagagtcggacaaaaattactttgaa
ggcacaggctatgctcgaattcctacccagccaaatgctcccttcccaaacttcatgcag
accatccaaactactgtggacagaggtctactgttcttcgcagaaaaccaggataacttc
atatctctgaatatagaagacggcaatctcatggtaaaatacaaactaaattcagagcca
cccaaagagaaaggaattcgagacaccatcaacaacgggagagatcacatgattttaatc
tcaattggaaaatcacaaaagcggatgttgataaatatgaataaacatagtataataatt
gaaggggaaatatttgatttcagcacatattacttgggaggaattccaattgcaatcaga
gaaaggtttaacatctcaacgcctgctttccaaggctgcatgaagaatctgaagaaaacc
agtggggttgtcaggttgaacgatacagtgggtgtgaccaaaaagtgctcagaagactgg
aagcttgtgcgaaccgcctcgttctccagaggaggacagatgagtttcacaaacttggat
gtgccctcacttgaccgcttccagctctcctttgggttccagacctttcaacccagcggt
acactactaaaccatcagacacggacaagtagcctactggtcaccctggaagatggtcat
attgcgttgagcaccagggacagcagcagcccgattttcaagtctccagggacctacatg
gatggtttactgcatcatgtatctgtaataagcgacacctcaggcctgcgccttctcatc
gatgaccaggttctgagaagaaaccaaaggctcgctagcttctctaatgcccagcagtcg
ctcagcatgggaggcggttatttcgagggttgtatcagcaacgtttttgtccaaaggatg
tcacagagtccagaagtcctggatatggccagcaagtctactaagagggatgcattccta
ggaggctgcagtttaaacaagccaccttttcttatgttgtttaagagtcccaagggattt
aacaaggcccggagtttcaatgtcaatcagctgttgcaagatgcacctcaggctgcaagg
agcatagaggcttggcaagatgggaagtcctgcctaccacctctgaacaccaaggccact
cacagagccctgcagtttggggacagtcctaccagccacttgctattcaagcttccccag
gagctgctgaaacccaggttacagttttctttggacatacagacaacttcctccagaggg
ctagtgtttcacacaggcaccagggactcctttgtggctctctatctctcagaaggccat
gtcatctttgccttgggggcaggagggaagaaactgagactcagaagcaaagagagatac
cacgatgggaagtggcactcggtggtgtttggactgagtggaagaaaggtgcacctggtg
gtggatgggctgagggcccaggaaggcagtttgcctggaaactctaccatcagccccaga
gaacaggtttacctggggttgtcaccatcaagaaagtcaaagagcctcccccagcacagt
tttgtggggtgtctgaggaacttccagttggactcaaaacccctggattccccctctgcg
aggtctggggtatctccctgcttaggtggctctttggagaaaggcatttatttctcccaa
ggaggaggtcacgtggtcctagccaattccgtgtccttggagccagcacttacgctcact
ctcagcattcgcccacgaagtctcaccggggtcttgatccacatcgcaagtcaatctgga
gagcacttaagtgtctacatggaggcagggaaggtcacgacctctatgaacagtgaggca
ggtgggaccgtgacatcaattacaccgaagagatctctgtgtgatggacaatggcactcg
gtgacagtctccattaaacagcacactctgcatctggaactggatacagacaatagctac
acagctgggcagctttccttcccaccgaacagcacccgagggtcactacacattggaggc
gtcccagacaaattgaaaatgcttacactccctgtgtggaactcattttttggctgtctg
aagaatattcaagtaaaccacatccctgtccccatcacagaagccaccgatgtccaaggt
tctgtcagcctgaatggctgccctgaccactaa

KEGG   Mus musculus (mouse): 16775
Entry
16775             CDS       T01002                                 

Gene name
Lama4
Definition
(RefSeq) laminin, alpha 4
  KO
K06241  laminin, alpha 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05143  African trypanosomiasis
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16775 (Lama4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16775 (Lama4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16775 (Lama4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16775 (Lama4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16775 (Lama4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16775 (Lama4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16775 (Lama4)
   05145 Toxoplasmosis
    16775 (Lama4)
   05143 African trypanosomiasis
    16775 (Lama4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3 BORCS6 Sec34
Other DBs
NCBI-GeneID: 16775
NCBI-ProteinID: NP_034811
MGI: 109321
Ensembl: ENSMUSG00000019846
Vega: OTTMUSG00000034993
UniProt: P97927
Position
10 B1; 10 20.02 cM
AA seq 1816 aa
MGWSTAWCSVLALWLLWCAVCSNAASGDGNAFPFDIEGSAVVGRQDPSETSDSGVTLGRL
PPAAERCDAGFFRTLSGECAPCDCNGNSHECLDGSGFCLHCQRNTTGEHCEKCLDGYIGD
SIRGTPRFCQPCPCPLPHLANFAESCYRKNGAVRCICKENYVGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEITGQCRNCLRNTTGFKCERCAPGYYGDARTAKNCAV
CNCGGGPCDSVTGECLEEGFEVPTGCDKCVWDLTDDLRLAALSIEESKSGLLSVSSGAAA
HRHVTDMNSTIHLLRTRLSERENQYTLRKIQINNSENTLRSLLPDVEGLHEKGSQASRKG
MLVEKESMDTIDQATHLVEQAHNMRDKIQEINSKMLYYGENQELGPEEIAEKLVLAQKML
EEIRSRQPFLTHRELVDEEADEAQELLSQAENWQRLHNDTRSLFPVVLEQLDDYNAKLSD
LQESINQALDHVRDAEDMNRAITFKQRDHEKQHERVKEQMEVVGASLSMSADSLTIPQLT
LEELDEIIKNASGIYAEIDGAKNELQGKLSNLSNLSHDLVQEATDHAYNLQQEADELSRN
LHSSDMNGLVQKALDASNVYENIANYVSEANETAELALNITDRIYDAVSGIDTQIIYHKD
ESDNLLNQARELQAKADSSNDEAVADTSRRVGGALWRKGALRDRLNDAVKQLQAAERGDA
HQRLGQSKLFIEEANKTTAAVQQVTTPMANNLSNWSQNLQTFDSSAYNTAVDSARDAVRN
LTEVVPQLLDQLRTVEQKRPASNISASIQRIRELIAQTRSVASKIQVSMMFDGQSAVEVH
PKVSVDDLKAFTSISLYMKPPPKPAEPTGAWVADQFVLYLGSKNAKKEYMGLAIKNDNLV
YVYNLGMKDVEILLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGE
FAGDDSLLDLTPEDTVFYVGGVPANFKLPASLNLPSYSGCLELATLNNDVISLYNFKHIY
NMDPSKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFDIEIRTPADN
GLVLLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTLKKAQINDAKYHEISIIYHN
DKKMILVVDRRHVKSTDNEKKKIPFTDIYIGGAPQEVLQSRTLRAHLPLDINFRGCMKGF
QFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGGFNFRT
LQPNGLLFYYTSGSDVFSISLDNGTVVMDVKGIKVMSTDKQYHDGLPHFVVTSISDTRYE
LVVDKSRLRGKNPTKGKAEQTQTTEKKFYFGGSPISPQYANFTGCISNAYFTRLDRDVEV
EDFQRYSEKVHTSLYECPIESSPLFLLHKKGKNSSKPKTNKQGEKSKDAPSWDPIGLKFL
EQKAPRDSHCHLSSSPRAIEHAYQYGGTANSRQEFEHEQGDFGEKSQFAIRLKTRSSHGM
IFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGLWHDVIFIREKSSGRL
VIDGLRVLEERLPPSGAAWKIKGPIYLGGVAPGRAVKNVQITSVYSFSGCLGNLQLNGAS
ITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRSSSGTLVH
GHSVNGEYLNVHMRNGQVIVKVNNGVRDFSTSVTPKQNLCDGRWHRITVIRDSNVVQLDV
DSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDSRPVSFSK
AALVSGAVSINSCPTA
NT seq 5451 nt   +upstreamnt  +downstreamnt
atgggttggagcacagcttggtgctcagtcctggccctgtggctcctctggtgtgctgtc
tgctccaacgcagcgtcaggggacggcaatgcgtttccttttgacatcgaggggagcgca
gtggtcggcaggcaagacccatcggagactagcgactcaggcgtgacactgggacgcctg
ccgcctgctgctgagagatgtgacgctggattcttccgcacactgtcaggagaatgtgca
ccctgtgactgtaatggcaattcccatgagtgcttggatggctccggattctgtctgcac
tgccagcggaacacaacaggagagcactgtgaaaaatgtctggatggctatattggagac
tccatcagaggcacaccccggttctgccagccgtgcccctgtcccttgccccacctggcc
aactttgcagaatcctgctacaggaaaaatggagctgttcggtgtatttgtaaagaaaac
tatgttggacctaactgtgaaagatgtgctcctggttactatggaaaccccttactcatt
ggaagcacctgtaagaaatgtgactgcagtggaaattcggatcccaacctgatctttgaa
gactgtgatgaaatcactggccagtgcaggaactgcttacgaaataccaccggattcaag
tgtgaacgctgtgcacctggttactatggagacgccaggacagccaagaactgtgcagtg
tgcaactgtgggggcggcccgtgtgacagtgtaaccggagagtgcttggaagaaggattt
gaagtccctacaggctgtgataagtgcgtctgggacttgaccgatgacctgcgattagca
gcgctctccatcgaagagagcaaatccgggctgctgagcgtgtcctctggcgctgcggcg
catagacacgtgaccgacatgaactctaccatccacctcctcagaacaaggctgtcagaa
agagaaaaccagtataccctaagaaagatacagataaacaactcggagaacacactgaga
agcctcctgcctgatgtagagggactccatgagaagggaagtcaagcctcaagaaagggt
atgctggttgagaaggaaagcatggatacaattgaccaagcaacccatcttgtcgagcaa
gcccacaacatgagggacaaaatccaagagatcaacagcaagatgctctactatggagag
aatcaggaacttggccccgaggaaatagctgagaagctggtgttggcccagaaaatgctg
gaagagatccgaagccggcagccattcctcacccatcgggagctggtggatgaggaggca
gatgaggcccaggaattgctgagccaagctgagaactggcagcggctgcacaatgacacc
cgctctttattccccgtggtgctggagcagctggacgactacaacgctaagctgtccgac
ctccaggaatccattaaccaggccctcgaccatgtcagggatgcagaagacatgaataga
gccatcactttcaagcagcgggaccatgagaaacaacatgagagagtgaaggaacagatg
gaagttgtgggtgcctctctgagtatgtctgcagactctcttaccatacctcagctcact
cttgaggaacttgatgagataataaagaatgcatctggaatttatgcagaaatagatgga
gccaaaaatgagctgcaaggaaaactatccaacctgagtaacctcagtcatgacttggtt
caggaagctacggaccatgcatacaatcttcaacaggaagccgatgagctaagcagaaat
ttgcacagttcagacatgaacgggctggtacagaaggctttggatgcatcaaacgtctat
gaaaatatcgccaattatgtcagtgaagccaacgaaacagcagaacttgctctgaatatc
actgatcgaatttatgatgctgtgagtgggattgacacgcagatcatttaccataaggat
gaaagtgacaaccttctcaatcaagccagagagctgcaggccaaggcagattctagcaat
gatgaagcagtggctgacaccagcaggcgtgtgggtggagccctgtggaggaagggcgcc
ctcagagacagactgaatgatgctgttaagcaactacaggcagcagagagaggggacgcc
caccagcgcctgggccagtccaagctcttcattgaggaagctaacaagacgacagcggct
gtccaacaggttaccacaccaatggctaacaacctcagcaactggtcccagaacctgcag
acctttgactcatctgcatataacactgcagtggactctgctcgggacgcagtgagaaac
ctcaccgaggttgtcccccagcttctggatcagcttcgtactgtggagcagaagcggcct
gcaagcaacatttctgccagcatccagaggatccgagagctcattgctcaaaccaggagt
gtcgcaagcaagatccaagtctccatgatgtttgatggccagtcagctgtcgaagtgcac
cccaaagtcagtgtggatgacctgaaggccttcacatccatcagcttgtacatgaagcct
cctccaaagccggcagagcccactggggcctgggtagcagatcagtttgtcctctacctc
ggaagcaaaaacgccaaaaaagaatacatgggtctggcaatcaaaaatgataacctggta
tacgtttacaatttggggatgaaagatgtggaaattctcctggattccaagcctgtgagc
tcctggcccgcttactttagtattgtcaagattgaaagggtagggaaacacggaaaggtg
ttcttgacagtccccagtctcagtagcacagcagaagaaaagtttattaagaagggggag
tttgcaggagatgactccttgctggatctgacccctgaggacactgtgttttacgttggt
ggggtgcctgcgaacttcaagctccctgccagcttaaacctgcccagctactcaggctgc
ctagagctggccactctgaataatgatgtgatcagcttgtacaacttcaagcacatctat
aatatggatccatcaaagtcagtgccctgtgccagggataaactggctttcactcagagt
agggctgccagctacttcttcgatggctccagttatgcagtggtgagggacatcacgagg
agagggaagtttggtcaggtgactcgctttgacatagaaatccgaacaccagctgacaat
ggccttgtgctcctgatggtcaatggcagtatgtttttcagcctcgaaatgcgcaatggc
tacctacatgtgttctatgactttggattcagcaatggccccgtgcatcttgaagacacg
ttgaaaaaagcccagattaatgatgcgaaatatcatgagatctcaatcatttatcacaac
gacaaaaaaatgattttggtggtggacagacggcacgttaagagcacagacaatgagaag
aaaaagattcctttcacggacatctacatcggaggtgcgccccaagaagtcttacagtcc
aggaccctaagagcacaccttcccctagatatcaactttagggggtgcatgaaggggttc
cagttccaaaagaaagatttcaatttactggagcagacagaaaccctaggagttggttat
ggatgcccagaggactctctgatatctcgcagagcatatttcaatgggcaaagttttatt
gcttcaattcagaaaatatctttctttgatggctttgaaggaggcttcaatttccgaaca
ttacagccaaatgggttactattctactacacatcagggtcggacgtgttttccatttca
ctggacaacggcactgttgtcatggacgtaaagggcatcaaggtcatgtcaacagacaag
cagtaccacgatgggctgccccacttcgtggtcacctccatctcagacacaagatatgaa
ctggtagtagacaaaagccgacttcgagggaagaatccaacaaaagggaaggcagagcag
actcaaacaactgagaagaagttctactttggtggctcacccatcagtcctcagtatgct
aatttcactggatgtataagcaatgcctactttaccaggttggatagagatgtggaagtc
gaagacttccagcgctattctgaaaaggtccacacttcactctatgagtgtccgattgag
tcgtcacctctgtttctccttcacaaaaaaggaaagaattcctcaaagcctaaaacaaac
aaacagggagagaagagtaaggatgcgccttcatgggatcctattggcctgaagtttctg
gaacagaaagctccaagagattcccactgccacctctccagcagccccagggcaatagaa
catgcctatcaatatggcggcacggccaacagtcgccaggagtttgaacacgaacaagga
gattttggtgaaaaatcccagtttgccattcgtctgaagacccgttcctcacatgggatg
attttctatgtctcagaccaagaagagaatgatttcatgaccctgttcttggcccatggt
cgcttggtctttatgtttaatgttggccataagaaactgaagattagaagccaggagaaa
tacaatgatggattgtggcatgatgtgatatttattcgggaaaagagcagtggtcgactg
gtcattgatggtctacgagtcctagaagaaaggcttccccctagtggcgctgcctggaaa
atcaagggtcccatttatctgggaggagtggctcccggaagagccgtgaaaaatgtccag
attacctccgtctacagcttcagtggctgccttggcaatctccagctcaatggtgcctcc
atcacctccgcttctcaaacgtttagcgtgaccccttgctttgaagggccaatggaaaca
ggaacttatttttccacagaaggcggctatgtggttctagatgagtctttcaatattggg
ttaaaatttgaaattgcctttgaagtccgcccccggagcagttctggaacccttgtccat
ggccacagcgtcaacggggaatacctgaacgtgcacatgagaaacggacaggtcatagtg
aaggtcaacaacggtgtcagagacttttctacctcagtaactcccaagcagaatctctgt
gatggcagatggcacagaattacagttattagagattcaaacgtggttcagttggatgta
gactcagaagtgaaccatgtagttgggccgttgaatccaaagccagttgatcacagggag
cctgtgtttgttggaggtgttccagagtctttactgacaccacgtttggctcccagcaaa
cccttcaccggctgcatccgccactttgtaattgacagccgccctgtgagcttcagtaaa
gctgccctggtcagtggtgctgtgagcatcaactcctgtcccacagcctga

KEGG   Mus musculus (mouse): 16776
Entry
16776             CDS       T01002                                 

Gene name
Lama5, AA408760, AA408762, AI853660, [a]5, laminin-511, mKIAA0533
Definition
(RefSeq) laminin, alpha 5
  KO
K06240  laminin, alpha 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16776 (Lama5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16776 (Lama5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16776 (Lama5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16776 (Lama5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16776 (Lama5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16776 (Lama5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16776 (Lama5)
   05145 Toxoplasmosis
    16776 (Lama5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_II Laminin_G_1 Laminin_B Laminin_G_3
Other DBs
NCBI-GeneID: 16776
NCBI-ProteinID: NP_001074640
MGI: 105382
Ensembl: ENSMUSG00000015647
Vega: OTTMUSG00000016271
UniProt: Q61001 Q3TZ05
Structure
PDB: 
2Y38

Position
2 H4; 2 102.7 cM
AA seq 3718 aa
MAKRGGQLCAGSAPGALGPRSPAPRPLLLLLAGLALVGEARTPGGDGFSLHPPYFNLAEG
ARITASATCGEEAPTRSVSRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTAANSNKAH
PVSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERS
TDFGHTYQPWQFFASSKRDCLERFGPRTLERITQDDDVICTTEYSRIVPLENGEIVVSLV
NGRPGALNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDIS
IGGRCVCHGHADVCDAKDPLDPFRLQCACQHNTCGGSCDRCCPGFNQQPWKPATTDSANE
CQSCNCHGHAYDCYYDPEVDRRNASQNQDNVYQGGGVCLDCQHHTTGINCERCLPGFFRA
PDQPLDSPHVCRPCDCESDFTDGTCEDLTGRCYCRPNFTGELCAACAEGYTDFPHCYPLP
SFPHNDTREQVLPAGQIVNCDCNAAGTQGNACRKDPRLGRCVCKPNFRGAHCELCAPGFH
GPSCHPCQCSSPGVANSLCDPESGQCMCRTGFEGDRCDHCALGYFHFPLCQLCGCSPAGT
LPEGCDEAGRCQCRPGFDGPHCDRCLPGYHGYPDCHACACDPRGALDQQCGVGGLCHCRP
GYTGATCQECSPGFYGFPSCIPCHCSADGSLHTTCDPTTGQCRCRPRVTGLHCDMCVPGA
YNFPYCEAGSCHPAGLAPANPALPETQAPCMCRAHVEGPSCDRCKPGYWGLSASNPEGCT
RCSCDPRGTLGGVTECQGNGQCFCKAHVCGKTCAACKDGFFGLDYADYFGCRSCRCDVGG
ALGQGCEPKTGACRCRPNTQGPTCSEPAKDHYLPDLHHMRLELEEAATPEGHAVRFGFNP
LEFENFSWRGYAHMMAIQPRIVARLNVTSPDLFRLVFRYVNRGSTSVNGQISVREEGKLS
SCTNCTEQSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGIWALLVEAEGVLLDYVVLLPS
TYYEAALLQHRVTEACTYRPSALHSTENCLVYAHLPLDGFPSAAGTEALCRHDNSLPRPC
PTEQLSPSHPPLATCFGSDVDIQLEMAVPQPGQYVLVVEYVGEDSHQEMGVAVHTPQRAP
QQGVLNLHPCPYSSLCRSPARDTQHHLAIFYLDSEASIRLTAEQAHFFLHSVTLVPVEEF
STEFVEPRVFCVSSHGTFNPSSAACLASRFPKPPQPIILKDCQVLPLPPDLPLTQSQELS
PGAPPEGPQPRPPTAVDPNAEPTLLRHPQGTVVFTTQVPTLGRYAFLLHGYQPVHPSFPV
EVLINGGRIWQGHANASFCPHGYGCRTLVLCEGQTMLDVTDNELTVTVRVPEGRWLWLDY
VLIVPEDAYSSSYLQEEPLDKSYDFISHCATQGYHISPSSSSPFCRNAATSLSLFYNNGA
LPCGCHEVGAVSPTCEPFGGQCPCRGHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELT
GQCICPPRTVPPDCLVCQPQSFGCHPLVGCEECNCSGPGVQELTDPTCDMDSGQCRCRPN
VAGRRCDTCAPGFYGYPSCRPCDCHEAGTMASVCDPLTGQCHCKENVQGSRCDQCRVGTF
SLDAANPKGCTRCFCFGATERCGNSNLARHEFVDMEGWVLLSSDRQVVPHEHRPEIELLH
ADLRSVADTFSELYWQAPPSYLGDRVSSYGGTLHYELHSETQRGDIFIPYESRPDVVLQG
NQMSIAFLELAYPPPGQVHRGQLQLVEGNFRHLETHNPVSREELMMVLAGLEQLQIRALF
SQTSSSVSLRRVVLEVASEAGRGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGLFLG
RCVPCQCHGHSDRCLPGSGICVGCQHNTEGDQCERCRPGFVSSDPSNPASPCVSCPCPLA
VPSNNFADGCVLRNGRTQCLCRPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPN
MIFSDCDPLTGACRGCLRHTTGPHCERCAPGFYGNALLPGNCTRCDCSPCGTETCDPQSG
RCLCKAGVTGQRCDRCLEGYFGFEQCQGCRPCACGPAAKGSECHPQSGQCHCQPGTTGPQ
CLECAPGYWGLPEKGCRRCQCPRGHCDPHTGHCTCPPGLSGERCDTCSQQHQVPVPGKPG
GHGIHCEVCDHCVVLLLDDLERAGALLPAIREQLQGINASSAAWARLHRLNASIADLQSK
LRSPPGPRYQAAQQLQTLEQQSISLQQDTERLGSQATGVQGQAGQLLDTTESTLGRAQKL
LESVRAVGRALNELASRMGQGSPGDALVPSGEQLRWALAEVERLLWDMRTRDLGAQGAVA
EAELAEAQRLMARVQEQLTSFWEENQSLATHIRDQLAQYESGLMDLREALNQAVNTTREA
EELNSRNQERLKEALQWKQELSQDNATLKATLQAASLILGHVSELLQGIDQAKEDLEHLA
ASLDGAWTPLLKRMQAFSPASSKVDLVEAAEAHAQKLNQLAINLSGIILGINQDRFIQRA
VEASNAYSSILQAVQAAEDAAGQALRQASRTWEMVVQRGLAAGARQLLANSSALEETILG
HQGRLGLAQGRLQAAGIQLHNVWARKNQLAAQIQEAQAMLAMDTSETSEKIAHAKAVAAE
ALSTATHVQSQLQGMQKNVERWQSQLGGLQGQDLSQVERDASSSVSTLEKTLPQLLAKLS
RLENRGVHNASLALSANIGRVRKLIAQARSAASKVKVSMKFNGRSGVRLRTPRDLADLAA
YTALKFHIQSPVPAPEPGKNTGDHFVLYMGSRQATGDYMGVSLRNQKVHWVYRLGKAGPT
TLSIDENIGEQFAAVSIDRTLQFGHMSVTVEKQMVHEIKGDTVAPGSEGLLNLHPDDFVF
YVGGYPSNFTPPEPLRFPGYLGCIEMETLNEEVVSLYNFEQTFMLDTAVDKPCARSKATG
DPWLTDGSYLDGSGFARISFEKQFSNTKRFDQELRLVSYNGIIFFLKQESQFLCLAVQEG
TLVLFYDFGSGLKKADPLQPPQALTAASKAIQVFLLAGNRKRVLVRVERATVFSVDQDNM
LEMADAYYLGGVPPEQLPLSLRQLFPSGGSVRGCIKGIKALGKYVDLKRLNTTGISFGCT
ADLLVGRTMTFHGHGFLPLALPDVAPITEVVYSGFGFRGTQDNNLLYYRTSPDGPYQVSL
REGHVTLRFMNQEVETQRVFADGAPHYVAFYSNVTGVWLYVDDQLQLVKSHERTTPMLQL
QPEEPSRLLLGGLPVSGTFHNFSGCISNVFVQRLRGPQRVFDLHQNMGSVNVSVGCTPAQ
LIETSRATAQKVSRRSRQPSQDLACTTPWLPGTIQDAYQFGGPLPSYLQFVGISPSHRNR
LHLSMLVRPHAASQGLLLSTAPMSGRSPSLVLFLNHGHFVAQTEGPGPRLQVQSRQHSRA
GQWHRVSVRWGMQQIQLVVDGSQTWSQKALHHRVPRAERPQPYTLSVGGLPASSYSSKLP
VSVGFSGCLKKLQLDKRPLRTPTQMVGVTPCVSGPLEDGLFFPGSEGVVTLELPKAKMPY
VSLELEMRPLAAAGLIFHLGQALATPYMQLKVLTEQVLLQANDGAGEFSTWVTYPKLCDG
RWHRVAVIMGRDTLRLEVDTQSNHTTGRLPESLAGSPALLHLGSLPKSSTARPELPAYRG
CLRKLLINGAPVNVTASVQIQGAVGMRGCPSGTLALSKQGKALTQRQAKPSVSPLLWH
NT seq 11157 nt   +upstreamnt  +downstreamnt
atggcgaagcgcggagggcagctctgcgcggggagcgcaccgggcgctcttggcccccgg
agccccgcgccacggccgctgctactgctgctggctggactggcgctggtaggcgaggcg
cgcactcccgggggcgatggcttcagcctgcacccgccctacttcaacctggcggagggc
gctcgcatcaccgcgtccgcgacctgcggcgaggaggccccgacgcgcagtgtctcacgc
cccaccgaggacctctactgcaagctggttgggggtccggtggctggcggagatcccaat
cagacaatccagggccagtactgtgacatctgtacagctgccaacagcaacaaggcacac
cctgtgagcaacgccatcgatggcacggagcgctggtggcagagcccacccctgtcccgt
ggcctggagtacaatgaggtcaacgtcacactggacctgggccaggtgttccatgtggcc
tatgtgctcatcaagtttgccaactcacctcggcctgacctctgggtgctggagcggtcc
acagacttcggtcacacttatcagccgtggcagttctttgcctcctccaagagggattgt
ttggagcggtttggacctcggactctagagcgcatcacgcaggacgacgacgtcatctgc
accacagaatactcgcgaatagtgcctttggagaatggcgagattgtggtgtccttggta
aatgggcgccctggggccttgaacttctcctactcaccgttacttcgagacttcaccaaa
gccaccaacatccgcttgcggtttctgcgaaccaacacgctactgggccacctcatgggc
aaggcgctgcgggaccccacagtcacccgcaggtattattacagcatcaaagacatcagc
attggtgggcgctgtgtctgtcatggccacgcagatgtctgtgacgccaaggacccattg
gatcctttcaggctgcagtgtgcctgccagcacaatacatgtggaggctcttgtgaccga
tgctgtccaggcttcaaccagcagccgtggaagcccgccaccacggacagcgccaatgag
tgccagtcctgcaattgccacggccatgcctacgactgttactacgaccctgaggtggat
cggcgcaatgccagccagaaccaggacaacgtgtaccagggtggaggtgtctgcctggat
tgccagcatcacactacgggtatcaactgtgagcgttgtctgcctggcttcttccgtgcc
cctgaccagcctctcgactcacctcatgtctgtcggccctgcgactgtgagtcagacttc
acggatgggacctgtgaagacttgacgggccgctgttactgcaggccgaacttcacagga
gagctatgtgctgcctgcgctgagggctacacggacttcccacactgctaccctctgcct
tcatttccccacaatgacacgagagaacaggtgcttcccgctggacaaatcgtgaactgt
gattgcaatgctgcagggacccagggcaatgcctgccggaaggacccaaggttgggacgg
tgtgtctgcaaacccaacttccggggtgcccactgtgagctctgtgctcctggattccac
gggcctagctgccacccatgccagtgttccagccctggggtagccaacagcctctgtgac
ccagagtctggccagtgcatgtgccgcaccggctttgagggggacaggtgtgaccactgt
gcccttggctatttccacttccctctctgtcagctgtgtggctgcagcccagcagggacc
ttgcctgaaggctgtgacgaggctggccgctgccagtgccgacctggctttgacggtcct
cactgtgaccgatgccttccaggataccatgggtatcccgactgtcacgcttgtgcctgt
gaccctcggggggccctggatcagcagtgtggagtgggcggtttgtgccactgccgtcct
ggctacacaggtgccacttgtcaggaatgtagccccggcttctacggcttccccagctgc
atcccctgccactgctctgccgatggctccttgcatacaacctgtgacccgacaaccggc
cagtgtaggtgtcgaccccgagtgacaggactacattgtgatatgtgtgtaccaggcgcc
tataacttcccctactgtgaagctggctcttgtcatcctgctggtctggccccagccaat
cctgcccttcctgagacacaggctccctgtatgtgccgggctcacgtggaagggccaagc
tgtgatcgctgtaaacctgggtactgggggctgagcgccagcaaccctgaaggctgcaca
cgctgcagctgtgacccacgaggcaccctgggtggagttactgagtgccagggcaatggg
cagtgcttctgcaaggctcacgtgtgtggcaagacctgtgcagcctgcaaggatggcttc
tttggcctggattatgctgactactttggctgccgtagctgtaggtgtgatgttggtggt
gccctgggtcaaggctgtgaaccaaagacaggtgcctgcaggtgccgccctaacacccaa
ggacccacctgtagcgagccagcgaaggaccactacttgccagacctgcaccacatgcgg
ctggaactagaggaggcggccactcccgagggccacgctgtacgctttggcttcaacccc
ctggagtttgagaactttagctggagaggctacgcacacatgatggctatccagcccagg
attgtggccaggctgaacgtgacctcccctgacctctttcggctggttttccgatatgtc
aaccgtggatcaaccagcgtgaatgggcagatctctgttcgtgaagagggcaagctttcc
agctgtaccaactgcacagagcagagccagccagtggctttcccacccagcactgagcct
gcctttgtcactgtgccccagaggggctttggggaaccctttgtgctgaaccccggcatc
tgggccttgctggtcgaggctgaaggtgtactcttggactacgtggtcctactgcccagc
acctactatgaggcagctctcctacagcatcgagtaacggaggcctgtacctaccgtccc
tcagccctgcactccacagagaactgtcttgtctatgctcacctacccctggatggcttc
ccttcagcagctggaactgaggccctgtgtcgccatgacaacagcctgccccggccctgc
cccacagagcagctcagcccctcacacccaccgctggcgacctgcttcggcagtgatgtg
gacatccagctcgagatggccgtgcctcagcctggccaatatgttctcgtggtggaatat
gtcggtgaggattcacaccaagagatgggagtggctgtgcacacccctcagagagccccc
cagcaaggggtgctcaacctccacccctgcccatacagctccctgtgccggagtccggct
cgggacacccagcatcatctagccatcttctacctggactctgaggctagcatccggctc
acagctgagcaagctcacttcttcctgcacagcgtcaccctggtacctgtggaggagttc
agtactgagtttgtggagccccgggtcttctgtgtgagcagtcatggaactttcaacccc
agcagtgctgcctgtctagcctcccgattcccgaagccaccgcagcccatcatccttaag
gactgccaggtcttgccgctgcctcccgacctgcctctgactcagtctcaggagctctca
ccaggtgcaccccccgagggaccacagcctcggccgccaactgcggtggatcctaatgca
gaacccaccttgctgcgccacccccagggcacggtggtcttcaccacccaggtgcccacc
ctgggccgctatgcctttctgctgcacggctaccagccggtccacccctccttccctgtg
gaggtactcattaatggtggccgcatctggcagggccacgccaacgccagcttttgtcct
catggttatggctgccgtaccctggtgttgtgtgagggtcagacgatgctggatgttaca
gacaacgagctcaccgtgactgtgcgtgtgccagaaggccggtggctctggctggactac
gtactcattgtccctgaggatgcttacagctccagttacctccaagaggagcctttggac
aaatcctatgacttcatcagccactgtgccacccagggctaccacattagccccagcagc
tcatctccattctgccggaatgccgccacctccttgtctctcttctacaacaacggggcc
ctcccttgtggctgccacgaggtgggtgccgtaagccccacgtgcgagcccttcgggggc
cagtgtccctgccggggccacgttattggccgtgactgttcccgctgtgccaccggctac
tggggtttccccaactgcaggccctgtgactgtggagcccgcctgtgtgacgagctcacg
ggccagtgtatctgtccaccacgcactgttccccctgactgcttggtctgccagccacag
agctttggttgccaccccttggtgggctgtgaggagtgtaactgctcagggcccggcgtc
caggagctgacggaccctacctgtgacatggacagcggccagtgcagatgcagacccaat
gtagctggacgtcgctgtgatacctgtgccccgggcttctatggctatcctagctgtcgc
ccctgtgactgccatgaggcaggcaccatggctagcgtgtgtgaccccctcacaggccaa
tgccattgcaaggagaacgtgcagggctcaagatgtgaccagtgtcgcgtggggaccttc
tccttggatgctgctaaccccaagggctgtacccgctgcttctgtttcggggccacagag
cgctgtgggaactctaacctcgcccgccatgagttcgtggacatggagggctgggtgctg
ttgagcagtgaccggcaggtggtaccccacgagcatcggcctgagatagagctgctgcac
gcagatctgcgctctgtggctgacactttctcagagctgtactggcaggctccgccctcc
tatctgggagacagggtgtcatcctacggtggaaccctccactatgagctgcactcagag
acccagcgaggtgatatcttcattccctacgagagccggccggacgtcgtgctgcagggc
aaccaaatgagcatcgccttcctggaactggcgtaccctccgcctggccaggttcaccga
ggacagctacagctggtagaggggaacttccggcacttggagactcacaaccccgtgtcc
cgagaagaactcatgatggtgctggccggcctggagcagctgcagatccgtgctctcttc
tcgcagacctcttccagtgtctccttgcgtagagtggtactggaggtggctagcgaggct
ggtagggggcctccagccagcaatgtggaactgtgtatgtgccctgccaactaccgtggg
gactcgtgccaggaatgtgcccctggctattaccgggacaccaagggtctcttcctaggc
cgatgtgtcccctgtcagtgccatggccattcagatcgctgccttcctggctctggcatt
tgtgtgggctgccagcacaacacagaaggggaccaatgtgagcgctgtaggcctggcttt
gtcagcagtgatcccagtaaccctgcatccccatgtgtgagctgcccttgccccttggca
gtgccctccaataattttgcagacggttgcgtcttaagaaatggccgaacccagtgcctc
tgcaggccaggctatgctggtgcctcctgcgagcggtgtgcacctggcttttttgggaac
cccctggtgctaggcagctcctgtcagccctgcgactgcagcggtaatggagaccccaac
atgatcttcagtgactgcgaccccctgacgggtgcctgtcgaggctgcctccgtcacacc
actgggccccactgtgaacgctgtgccccaggcttctatggcaatgctttgttgccaggc
aactgcacccggtgtgactgttccccatgtgggacagaaacctgtgatccccagagtgga
cgctgcctgtgcaaagcaggcgtgactggacaacgttgtgaccgctgtttggaaggatac
ttcggttttgagcaatgccagggctgccgcccttgtgcctgtggaccagctgccaagggc
tccgagtgccaccctcagagcggtcagtgtcactgccagccagggaccacaggaccccag
tgcctcgagtgcgcccctggctactggggcctcccagagaagggctgcaggcgctgccag
tgtccccgaggccactgtgacccacacacgggccactgcacctgtcccccggggctcagc
ggggaacgctgtgacacctgcagccagcagcaccaggtgcctgtaccgggcaagcctggg
ggccatggcatacactgtgaagtgtgtgaccactgtgtggttctccttctggatgacctc
gagcgggctggtgccctcctccccgctatccgtgagcagctgcagggtatcaatgccagc
tccgcggcctgggccaggctgcacaggctgaatgcctccattgctgacctgcagagtaaa
ctccggagcccaccgggaccccgctaccaggcagcacagcagctacagactctagagcag
cagagtataagccttcaacaggacacggagaggctgggcagtcaggccacaggggtccaa
ggtcaggcaggccagctactggacaccacagagtccacactgggccgggcacagaagttg
ttggagtctgtgcgagctgtgggccgtgccctgaatgagctggcatctcgcatgggccaa
ggatctccaggcgatgccttggtaccgtctggcgagcagctgcgctgggctctggctgaa
gtggagcggctgctctgggatatgcggacgcgtgacctgggggcccagggggcagtggca
gaggccgaactggccgaagcccagaggctgatggctcgtgtccaggagcagctgaccagc
ttctgggaggagaaccagtcattggccacacacattcgggaccagctggctcagtatgag
tctggcctcatggatcttcgtgaggccctgaaccaggccgttaataccacccgggaggct
gaggaactcaacagccgcaaccaggaacggctgaaggaagccctgcaatggaaacaggaa
ctgtcccaggacaatgccaccctgaaggccactcttcaagctgccagtctcatcttgggc
catgtttctgagcttctgcagggcatagaccaggctaaggaggacctagagcacctggcg
gccagcctggatggagcctggacacccttactgaagaggatgcaggccttttcccctgcc
agcagcaaggtggacttggtagaggctgctgaggcccacgctcagaagctgaaccagctg
gcaatcaacctgtctggcatcatccttggcatcaatcaggaccgcttcatccagagggct
gtggaagcctccaatgcctacagcagcatccttcaggccgttcaggctgccgaggatgcg
gcaggccaggcactgaggcaggccagccgcacatgggagatggtggtgcagcggggccta
gcagctggagcccggcagctgttagccaacagcagtgccctggaggagaccatccttgga
caccaggggaggctgggccttgctcagggccgtctgcaggctgcggggatccagcttcat
aatgtctgggccaggaagaaccagctagcagcccagatccaggaggcacaagccatgctg
gccatggacacgagcgagaccagtgagaagattgctcacgccaaggctgtggctgccgaa
gccctcagtacggccacccacgtgcagtctcagcttcagggtatgcagaagaatgtggag
aggtggcagagccagctgggaggcctgcaaggccaggacctgagccaggtggaacgggat
gcaagcagttcagtgtccaccctggagaagacattgccacagctgctggccaaactgagc
cgtctagagaaccgtggagttcacaatgccagcctggctttgtctgccaacattggtcgt
gtgcgcaagctcattgcccaagcccggagtgccgccagcaaggtcaaggtgtccatgaag
ttcaatgggcgttcaggggtacgactgcgtaccccacgagaccttgccgaccttgctgcg
tacactgccctcaagttccacatccagagcccagtgccagcgcccgaacctggcaagaac
acgggggaccactttgttctgtacatgggcagccgccaggccactggggactacatggga
gtgtctctgcgtaatcagaaggtgcactgggtgtacaggctaggaaaggctggccccaca
actctcagcatcgacgagaacatcggggagcagtttgcagccgtcagcatcgacaggacc
ctccagtttggccacatgtctgtcaccgtggagaaacagatggttcatgagatcaaggga
gacacggtggcccctgggagcgagggactactcaacctgcatcctgacgattttgtcttc
tacgtgggaggataccccagcaacttcacgccccctgaacccctccgattccctggctac
ctgggctgcattgagatggaaacactgaatgaggaggtggtcagcctctacaattttgag
cagaccttcatgctggacacggcagtagataaaccttgtgctcgctccaaggccaccggt
gacccatggctcacagatggctcctacctggatggcagtggctttgcccgcatcagcttt
gagaagcagttcagcaacacaaaacgctttgaccaggagctgcggcttgtgtcctacaat
gggatcatctttttcctcaagcaagagagccagttcttgtgcctggcagtgcaggaaggc
accctggtgctcttctatgacttcggctctggcctgaagaaggccgacccactgcagccc
ccacaagccttgacggcagccagcaaggcgatccaagtgtttctattggctggcaatcgc
aaacgtgtgttggtgcgtgtggagcgggccactgtgttcagcgtagaccaggataacatg
ctggagatggctgatgcctactacttgggaggtgtgccacctgaacagctgcccttgagc
ctacggcagctcttcccctccggaggctctgtccgtggctgcatcaagggtattaaggct
ctgggcaagtacgtggacctcaaacggttgaacaccacgggcatcagtttcggctgcacc
gctgacctgctagtgggacgcaccatgacttttcacggccacggcttcctgcccctggca
cttcctgatgtggcacccatcaccgaagtggtctattctggctttggctttcgtggcacc
caggacaacaacctgctgtattaccgtacctccccggatgggccgtaccaggtatccctg
agggagggccacgtgacactccgttttatgaaccaagaggtggaaactcaaagggtcttt
gctgatggtgctcctcactatgttgccttctatagcaatgtcacaggggtatggctgtat
gtggatgaccagctacaactagtaaagtctcatgagagaacaactcccatgctccaacta
cagcccgaggaaccctcacggcttctcctgggaggcctgcctgtgtctggtaccttccac
aacttcagtggctgcatcagcaatgtttttgtacagcgacttcggggaccacagcgtgtg
tttgacctacaccagaacatggggagtgtcaatgtaagcgtaggctgtacaccagcccaa
ctcatcgagacctcaagggccacggctcagaaggtttcccgccgtagtcgacaacccagc
caggaccttgcctgcacgacaccctggctccctgggactattcaggatgcataccagttt
gggggacccctgcccagttacctacagtttgtgggtatctctccgtcccacaggaatagg
ctccacctctccatgcttgtccgtccacatgcggcttcccagggcctcctgctctctaca
gcccccatgtcgggccgcagcccttcgttggtactctttctaaaccatggacactttgtc
gcacagactgagggccctgggccccggctccaggtccagagtcgccagcactcacgggct
ggccagtggcacagggtgtccgtccgctggggaatgcagcagatccagcttgtggtggac
ggcagccagacctggagccagaaggctctccaccatcgggtccccagggcagagcgacca
cagccctacaccctctctgtaggaggtcttcctgccagcagttacagttccaagctccct
gtgtctgtggggttcagcggctgtctgaagaaattacagctggataagcggccactgagg
accccaacgcaaatggtgggggtcacaccctgtgtctcaggccccctggaagatggcctg
ttcttcccaggcagtgagggagttgtcacattagagctccccaaggccaagatgccctat
gtgagcctggagctagagatgcggcccttggcagctgctggcctcatcttccacctgggc
caggccctggccactccctacatgcagctgaaggtgctgacagaacaggtcctgctgcag
gcaaatgatggggcaggggagttttccacgtgggtgacctaccccaagctttgtgatgga
cggtggcaccgagtggcagtgatcatgggcagggacacactccggctggaggtagacaca
cagagcaaccacaccacaggccgtttgccagagagcttggctggttctccagcacttctg
cacctcgggagcctgcccaagtcttcaactgctcggccagagctccctgcctaccgagga
tgcttgaggaagctgctgatcaatggggcccctgtcaacgtgactgcttctgtacaaatc
cagggggcagtggggatgcgcggatgcccctcaggaaccctagcactttccaagcaggga
aaggcactgacccagaggcaggccaagcccagtgtctccccgctactttggcattga

KEGG   Mus musculus (mouse): 16777
Entry
16777             CDS       T01002                                 

Gene name
Lamb1, C77966, C80098, C81607, D130003D08Rik, Lamb, Lamb-1, Lamb1-1
Definition
(RefSeq) laminin B1
  KO
K05636  laminin, beta 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16777 (Lamb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16777 (Lamb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16777 (Lamb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16777 (Lamb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16777 (Lamb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16777 (Lamb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16777 (Lamb1)
   05145 Toxoplasmosis
    16777 (Lamb1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C HU-CCDC81_bac_2
Other DBs
NCBI-GeneID: 16777
NCBI-ProteinID: NP_032508
MGI: 96743
Ensembl: ENSMUSG00000002900
Vega: OTTMUSG00000035464
UniProt: E9QN70 Q3UHL7
Structure
PDB: 
5MC9 4AQS

Position
12 A2; 12 13.39 cM
AA seq 1786 aa
MGLLQVFAFGVLALWGTRVCAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMC
RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGG
VCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVG
LIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCY
CKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQC
NEVESGYYFTTLDHYIYEAEEANLGPGVIVVERQYIQDRIPSWTGPGFVRVPEGAYLEFF
IDNIPYSMEYEILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPG
SRYVVLPRPVCFEKGMNYTVRLELPQYTASGSDVESPYTFIDSLVLMPYCKSLDIFTVGG
SGDGEVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALIHQTGLACECDPQGS
LSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPNGCKPCDCHLQGSASAFCDAITGQC
HCFQGIYARQCDRCLPGYWGFPSCQPCQCNGHALDCDTVTGECLSCQDYTTGHNCERCLA
GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCAS
GFFGNPSDFGGSCQPCQCHHNIDTTDPEACDKETGRCLKCLYHTEGDHCQLCQYGYYGDA
LRQDCRKCVCNYLGTVKEHCNGSDCHCDKATGQCSCLPNVIGQNCDRCAPNTWQLASGTG
CGPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPDVECRACDCDPRGIE
TPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDAIIGELTNRTHKF
LEKAKALKISGVIGPYRETVDSVEKKVNEIKDILAQSPAAEPLKNIGILFEEAEKLTKDV
TEKMAQVEVKLTDTASQSNSTAGELGALQAEAESLDKTVKELAEQLEFIKNSDIQGALDS
ITKYFQMSLEAEKRVNASTTDPNSTVEQSALTRDRVEDLMLERESPFKEQQEEQARLLDE
LAGKLQSLDLSAVAQMTCGTPPGADCSESECGGPNCRTDEGEKKCGGPGCGGLVTVAHSA
WQKAMDFDRDVLSALAEVEQLSKMVSEAKVRADEAKQNAQDVLLKTNATKEKVDKSNEDL
RNLIKQIRNFLTEDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVETLSQVEVI
LQQSAADIARAELLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDI
QGTQNLLTSIESETAASEETLTNASQRISKLERNVEELKRKAAQNSGEAEYIEKVVYSVK
QNADDVKKTLDGELDEKYKKVESLIAQKTEESADARRKAELLQNEAKTLLAQANSKLQLL
EDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL
NT seq 5361 nt   +upstreamnt  +downstreamnt
atggggctgctccaggtgttcgcctttggtgtcctagccctatggggcacccgagtgtgc
gctcaggaaccggagttcagctatggctgcgcagaaggcagctgctaccctgccactggc
gaccttctcatcggccgagcgcaaaagctctccgtgacttcgacatgtggactgcacaaa
ccagagccctactgtattgttagccacctgcaggaggacaagaaatgcttcatatgtgac
tcccgagacccttatcacgagaccctcaaccccgacagccatctcattgagaacgtggtc
accacatttgctccaaaccgccttaagatctggtggcaatcggaaaatggtgtggagaac
gtgaccatccaactggacctggaagcagaattccatttcactcatctcatcatgaccttc
aagacattccgcccagccgccatgctgatcgagcggtcttctgactttgggaaggcttgg
ggcgtgtacagatacttcgcctacgactgtgagagctcgttcccaggcatttcaactgga
cccatgaagaaagtggatgacatcatctgtgactctcgatattctgacattgagccctcg
acagaaggagaggtaatatttcgtgctttagatcctgctttcaaaattgaagacccttat
agtccaaggatacagaatctattaaaaatcaccaacttgagaatcaagtttgtgaaactg
cacaccttgggggataaccttttggactccagaatggaaatccgagagaagtactattac
gctgtttatgatatggtggttcgagggaactgcttctgctatggccacgccagtgaatgc
gcccctgtggatggagtcaatgaagaagtggaaggaatggttcacgggcactgcatgtgc
agacacaacaccaaaggcctgaactgtgagctgtgcatggatttctaccacgatttgccg
tggagacctgctgaaggccggaacagcaacgcctgcaaaaaatgtaactgcaatgaacat
tccagctcgtgtcactttgacatggcagtcttcctggctactggcaacgtcagcggggga
gtgtgtgataactgtcagcacaacaccatggggcgcaactgtgaacagtgcaaaccgttc
tacttccagcaccctgagagggacatccgggaccccaatctctgtgaaccatgtacctgt
gacccagctggttctgagaatggcgggatctgtgatgggtacactgatttttctgtgggt
ctcattgctggtcagtgtcggtgcaaattgcacgtggagggagagcgctgtgatgtttgt
aaagaaggcttctacgacttaagtgctgaagacccgtatggttgtaaatcatgtgcttgc
aatcctctgggaacaattcctggtgggaatccttgtgattctgagactggctactgctac
tgtaagcgcctggtgacaggacagcgctgtgaccagtgcctgccgcagcactggggttta
agcaatgatttggatgggtgtcgaccttgtgactgtgaccttggaggggcgctgaacaat
agctgctccgaggactccggccagtgctcctgcctgccccacatgattgggcggcagtgt
aacgaggtggagtccggttactacttcaccaccctggaccactacatctacgaagccgag
gaagccaatctggggcctggagtcattgtggtggaaaggcagtacattcaggaccgcatt
ccttcctggacaggacctgggttcgtccgggtgcctgaaggggcttatttggagtttttc
attgacaacataccgtattccatggagtatgaaatcctgattcgctatgagccacagctg
ccggaccactgggagaaagctgtcatcactgtacagcggccggggaagattccagccagc
agccgatgtggtaacaccgttcccgatgatgacaaccaggtggtgtccttgtcaccgggc
tcaagatacgttgtcctccctcgccccgtgtgctttgagaagggaatgaactacacggtg
aggttggagctgccccagtatacggcatcgggcagtgacgtggagagcccttacacgttc
atcgactcgcttgttctcatgccctactgtaaatcgctggacatcttcactgttggcggc
tcaggcgatggggaggtcaccaatagtgcctgggaaaccttccagcgctacaggtgtctg
gagaacagcaggagtgtggtaaaaacacccatgacagatgtctgcagaaacattatcttc
agcatttctgccttgattcaccagacgggccttgcttgtgaatgtgacccccagggatct
ctgagttctgtgtgtgaccccaatggtggccagtgccagtgccgtcctaatgtggttgga
agaacctgcaacaggtgtgccccgggcacctttggctttggccccaacggatgcaaacct
tgtgactgccatctgcaagggtctgccagtgccttctgcgatgcgatcactggccagtgc
cactgtttccagggcatctatgctcggcagtgtgaccgatgtctccctgggtattggggc
tttcccagctgccagccctgccagtgtaatggtcatgctctagactgtgacacagtgaca
ggggagtgtctgagctgtcaggactacaccacgggccacaactgcgaaaggtgcctggct
ggctactacggtgatcccatcattgggtcaggagaccactgtcgcccttgcccttgtcct
gatggtcctgacagtggacgacagtttgccaggagctgttatcaagaccccgtcactctc
cagcttgcgtgtgtttgtgatcctgggtacattggctccagatgtgatgactgtgcctct
ggattttttggcaatccctcagactttgggggttcatgtcaaccatgtcagtgccaccac
aacattgacactaccgatccagaagcctgtgacaaggagacgggacgatgcctcaagtgc
ctgtaccacacagaaggggaccattgccagctctgccagtatgggtactacggcgatgct
cttcggcaagactgtagaaagtgtgtctgcaattacctgggcacggtgaaggaacattgt
aatggctctgactgccactgtgacaaagccactggtcagtgctcgtgccttcccaatgtg
atcgggcagaactgtgaccggtgtgcgcccaacacctggcagctggctagcgggactggc
tgcgggccctgcaattgcaatgctgcgcattcctttgggccatcctgcaacgagttcaca
gggcagtgccagtgcatgccgggctttggaggccgaacctgcagcgagtgccaggagctc
ttctggggagaccctgatgtggaatgccgagcctgtgactgtgatcccaggggcattgag
acacctcagtgtgaccagtccacgggccagtgtgtctgtgtggagggtgtagagggtcct
cgctgcgacaagtgcaccagaggttactcgggggtctttcctgactgcacaccctgccac
cagtgctttgctctctgggatgctatcattggtgagctgaccaacaggacccacaaattc
ctggagaaagccaaggctctgaaaatcagtggtgtgattggtccctaccgagagaccgtg
gactctgtagagaagaaagtcaatgagataaaagacatcctggcccagagcccagcagcg
gaaccactgaaaaacattggcattctcttcgaggaggcagagaaactaaccaaagatgtc
acagaaaagatggcgcaggtagaagtgaaattaactgatacagcttcacagagtaacagc
acagctggagagctcggcgcactgcaggcagaagcagagagccttgacaagaccgtgaag
gagctggcagaacagctggagtttatcaaaaactccgatattcagggcgccttggatagc
atcaccaagtatttccagatgtctcttgaggcagagaagcgggtgaatgcctccaccaca
gaccccaacagcactgtggagcagtctgccctcacgcgagacagagtagaagatctgatg
ttggagcgagagtctccgttcaaggagcagcaggaggaacaggcacgcctcctggacgaa
ctggccggcaaactgcaaagtctcgacctgtcggctgttgcacagatgacctgtggaaca
cctccaggggctgactgttctgaaagtgaatgtggtggccccaactgcagaactgacgaa
ggagagaagaagtgtggggggcctggctgtggtggtctggtcactgtggcccacagtgct
tggcagaaagccatggattttgaccgtgatgtcctgagtgccctggctgaagtcgaacag
ctctccaagatggtctctgaagcaaaagtgagagcagatgaggcgaagcagaatgcgcag
gatgtcctgttaaaaacaaatgctaccaaagaaaaagtggacaagagcaacgaggacctg
cggaacctcatcaagcagatcagaaacttcctgactgaggatagtgctgatctagacagt
attgaagcagttgctaatgaagtactgaaaatggaaatgcctagcacgccacagcagtta
cagaacctaacagaagacattcgggagcgagttgaaaccctctctcaagtagaggttatt
ttgcagcagagtgcagctgacattgccagagctgagctgttgcttgaggaagctaagaga
gcaagcaaaagtgcaacagatgttaaagtcactgcagacatggtgaaggaagcattagaa
gaagcagaaaaggcccaggttgcagcagagaaggcgattaaacaagctgatgaggatatc
caaggaacccaaaacctgctaacatcgattgaatctgaaacggcagcttctgaggaaacc
ctgaccaacgcctcccagcgcatcagcaagcttgagaggaacgtggaagagcttaagcgt
aaagctgcccagaactctggggaggcagaatatatcgaaaaagtagtatattctgtaaaa
cagaatgcagacgatgttaagaagactctagatggcgaacttgatgaaaagtataagaag
gtagaaagtttaattgcccaaaaaactgaagagtcagcagatgccaggaggaaagctgag
ctgctacaaaatgaagcaaaaacactcttggctcaagctaacagcaagctccagctgttg
gaagacttagaaagaaaatatgaggacaatcaaaaatacttagaagataaagctcaagaa
ttggtgcgactggaaggagaggttcgctccctccttaaggacataagtgagaaagttgcg
gtttacagcacctgcttataa

KEGG   Mus musculus (mouse): 16779
Entry
16779             CDS       T01002                                 

Gene name
Lamb2, AW211941, L, Lamb, Lamb-2, Lams, np, npht
Definition
(RefSeq) laminin, beta 2
  KO
K06243  laminin, beta 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16779 (Lamb2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16779 (Lamb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16779 (Lamb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16779 (Lamb2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16779 (Lamb2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16779 (Lamb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16779 (Lamb2)
   05145 Toxoplasmosis
    16779 (Lamb2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 16779
NCBI-ProteinID: NP_032509
MGI: 99916
Ensembl: ENSMUSG00000052911
Vega: OTTMUSG00000050824
UniProt: Q61292 Q3USI2
Position
9 F2; 9 59.4 cM
AA seq 1799 aa
MEWASGEPGRGRQGQPLPWELRLGLLLSVLAATLAQAPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHTHSCH
FDMAVYLASGNVSGGVCDGCQHNTAGRHCEFCRPFFYRDPTKDMRDPAVCRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASDPRGCQRCQCNSRGT
VPGSSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEAAQGQGLEVVERLVTNRETPSWTGP
GFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELMVQRPGPVSAHSPCGHV
LPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKLKLKLIGTGGRAQPETSYSGLLIDSLV
LQPHVLVLEMFSGGDAAALERRTTFERYRCHEEGLMPSKAPLSETCAPLLISVSALIYNG
ALPCQCDPQGSLSSECSPHGGQCRCKPGVVGRRCDVCATGYYGFGPAGCQACQCSPDGAL
SALCEGTSGQCPCRPGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDTHTGACLGCRDY
TGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCQCREG
YTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHNTEGPHC
GYCKPGFHGQAARQSCHRCTCNLLGTDPRRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHC
APNFWNFTSGRGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQ
CRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDR
VVQDLAARTRRLEQWAQELQQTGVLGAFESSFLNMQGKLGMVQAIMSARNASAASTAKLV
EATEGLRHEIGKTTERLTQLEAELTAVQDENFNANHALSGLERDGLALNLTLRQLDQHLE
ILKHSNFLGAYDSIRHAHSQSTEAERRANASTFAVPSPVSNSADTRRRTEVLMGAQKENF
NRQHLANQQALGRLSAHAHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGG
LGCSGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDKAN
ASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLASEI
AERVRSLADVDTILAHTMGDVRRAEQLLQDAHRARSRAEGERQKAETVQAALEEAQRAQG
AAQGAIWGAVVDTQNTEQTLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSL
AASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEAR
DLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5400 nt   +upstreamnt  +downstreamnt
atggagtgggcctcaggagaaccagggaggggcaggcagggacagcctttgccatgggaa
cttcgcttgggcctacttctaagtgtgctggctgccacattggcccaggccccgtccttg
gatgtacctggctgttctcgaggaagctgctatccagccaccggtgacctgttggtgggc
cgtgcggacagactgacggcctcatccacgtgtggcttgcatagccctcaaccctactgt
attgtcagtcacctgcaggacgaaaagaagtgtttcctgtgtgactcccgacgtcccttc
tctgctcgagacaacccaaatagtcatcggatccagaatgtagtcaccagctttgcgcca
caacgccggacagcctggtggcaatcggagaacggggttccaatggtcaccatccaactg
gacctggaagctgagtttcatttcacccacctcattatgacgttcaagacgttccggcct
gctgctatgctggtggagcgttctgcagactttggccgcacctggcacgtgtaccgatat
ttttcctatgactgcggggctgacttcccgggaatcccactggccccgccacgtcgctgg
gatgatgtagtgtgtgagtcccgctactcagaaatcgagccgtctacggaaggcgaggtc
atctatcgtgtgctggaccctgctattcctatcccagacccctacagctcacggattcag
aacctgttgaagatcaccaacctacgagtgaacttaacccggcttcacacactgggagac
aacttgcttgacccacggagggagatccgggaaaaatactattatgctctctatgaactt
gtcatccgtggcaactgcttctgctatggccacgcctcacagtgtgcgcctgcaccaggg
gcgccggcccatgctgagggcatggtacacggagcctgtatctgcaagcacaatactcgt
ggactcaactgtgagcagtgtcaggatttctatcaggaccttccctggcaccctgcagag
gacggccatactcacgcctgtcggaagtgtgagtgcaacgggcatactcatagctgccac
tttgacatggctgtctacctggcatctggaaatgtaagtggaggcgtatgcgatgggtgt
cagcacaacacagctgggcgccattgtgagttctgccggcccttcttctaccgtgacccc
accaaggacatgcgggacccagctgtgtgccgtccttgtgactgtgaccctatgggttct
caagatggtggtcgctgtgattctcatgatgaccctgtgctaggactggtctcaggccag
tgtcgctgcaaagaacacgtggttggcactcgctgccagcaatgccgtgatggcttcttt
ggacttagtgccagtgaccctcgagggtgccagcgttgccagtgtaattcacggggcaca
gtgcctgggagctccccttgtgactccagtagtggaacctgtttctgcaagcgtctggtg
accggacatggctgtgaccgctgtctgcctggccactggggcctgagccatgacctgctg
ggctgccgtccctgtgactgtgatgtgggcggtgccttggatcctcagtgtgatgaggcc
accggtcagtgccgctgccgccaacacatgattgggcggcgctgcgaacaagtgcagcct
ggctacttccggccttttctggaccatttaacctgggaggctgaggctgcccaagggcag
gggcttgaggtggtagagcggctggtgaccaaccgagagactccgtcctggactggccca
ggctttgtgcggctgcgagaaggtcaggaagtggagttcctggtgacctctttgcctagg
gccatggactatgacctgctactgcgctgggagccccaggtccctgagcaatgggcagag
ctggaactgatggtgcagcgtccggggcctgtgtctgctcacagtccgtgcgggcatgtg
ctgcctaaggatgaccgcattcaggggatgcttcacccaaacaccaggtttttggtgttt
cccagacctgtctgccttgagcctggcatctcctacaagctgaagctgaaactgatcgga
acagggggacgagcccagcctgaaacctcctactctggattactcattgactcgctggtc
ctgcagccccacgtcttggtgctagagatgtttagtgggggcgatgctgctgctctggag
cgccgtaccacctttgaacgctaccgctgccatgaggaaggtctgatgcccagcaaggcc
cctctatctgagacctgtgcccccctcctcatcagcgtgtccgccttgatctacaatggc
gccttgccatgtcagtgtgaccctcaaggctcactgagttctgaatgcagtcctcacggt
ggccagtgccggtgcaaacctggagtggttggacgccgttgtgatgtctgtgctactggc
tactatggctttggccctgcaggctgtcaagcctgccagtgtagtcctgatggagcactc
agtgccctctgtgaagggactagtggacagtgcccctgccgacctggtgcctttggtctt
cgctgtgaccactgtcaacgtggccagtggggattccctaattgccggccgtgtgtctgc
aatgggcgtgcggatgagtgtgatacccacacaggcgcttgcctgggctgccgtgattac
acggggggcgagcactgtgaaaggtgcattgctggttttcatggggacccacggctgcca
tatgggggccagtgccggccttgtccctgccctgaaggccctgggagccagcgacacttt
gctacttcttgccaccgggatggatattcccagcaaattgtgtgccagtgtcgagaaggc
tacacagggcttcggtgtgaagcttgtgcccccgggcactttggggacccatcaaagcca
ggtggcaggtgccaactgtgtgagtgcagtggaaacattgatcccatggaccctgatgcc
tgtgatccccacacggggcaatgcttgcgttgtttacacaacacagaggggccccactgt
ggctattgcaagcctggcttccatgggcaagctgcccgacagagctgtcaccgctgtacc
tgcaaccttctgggcacagatcccaggcggtgcccatctaccgacctgtgccattgtgac
ccaagcactgggcagtgcccatgccttccccatgtccaaggcctcaactgtgaccattgt
gcccccaacttttggaacttcaccagtggccgtggctgccagccttgtgcttgtcaccca
agccgggccagaggccctacctgcaatgagttcacagggcagtgtcactgtcatgctggc
tttggtgggaggacttgttctgagtgccaagagctctactggggagaccctggtctgcag
tgccgtgcctgtgactgtgatcctagaggaatagacaaacctcagtgtcatcgttccaca
ggccactgtagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgctcgtggc
ttctcaggggtttttcctgcttgtcacccctgccacgcttgctttggagactgggatcgt
gtggtacaggacctggctgctcggacgcggcgcctggagcagtgggctcaggagttgcag
caaacaggagtgctgggtgcctttgagagcagctttttgaacatgcaggggaagctaggc
atggtgcaggccattatgagtgcccgcaatgcctcagccgcctctacggcgaagcttgta
gaggccacagagggactacgtcatgaaatcgggaagaccaccgagcgcctgactcagtta
gaagcagagctaacagctgtgcaggatgagaacttcaatgccaaccatgcactcagtggt
ctggagagagacgggcttgcgcttaatctcaccctgaggcagctggatcagcatctggag
atcctcaaacattcaaatttcttaggtgcctatgacagcatccgacatgcccacagccag
tccacagaggcagagcgccgtgccaacgcctccacctttgcagtacccagccctgtgagc
aactcagcagatacccggcgtcggacggaagtgctaatgggtgcccaaaaagaaaacttc
aaccgccaacatttggccaaccagcaggcactgggacggctctctgcacatgcccacacc
ctgagcctgacgggcataaatgagttggtgtgtggggcaccaggggacgcaccctgtgcc
accagcccttgtgggggtgccggatgtcgggatgaagatgggcagccccgttgtggtggc
ctcggttgcagtggggcagcagccacggcagatctagcgctgggccgggctcggcacacg
caggcagagctgcagcgggcactggtagaaggtggcggcatcctcagccgggtgtctgag
actcgtcggcaggcagaagaggcacagcagcgagcacaggcagccctggacaaggctaat
gcttccaggggccaggtggaacaggccaatcaggagcttcgagaacttatccagaatgtg
aaagacttcctcagccaggagggagccgatcctgacagtattgaaatggtagcgactcgg
gtgctagacatctccatcccggcctcacccgagcagatccagcgcctagccagtgagatt
gcagaacgcgtccgaagcctggccgacgtggacacaatcctggcccataccatgggcgac
gtgcgtcgggctgaacagctactgcaagatgcgcaccgggcacggagccgggccgagggt
gagagacagaaggcagagacagtccaagcggcactggaggaggctcagagggcacaagga
gctgctcagggtgccatctggggagcagtggttgacacacaaaacacagagcagaccctg
cagcgggtccaggagaggatggcaggtgcagagaagtctctgaactctgccggtgagcgg
gctcggcaattagacgccctcctggaggccctgaaactgaaacgggcaggaaatagcctg
gcagcatctacagcggaagaaacagcaggcagtgcccagagccgtgccagggaggctgag
aaacaactacgggaacaagtaggtgaccaataccaaacagtgagggcgttggcagagcgg
aaggctgaaggtgttctggctgcacaagccagggcagaacaactgcgggatgaggctcgg
gacctgttgcaggccgctcaggataagctgcagcggctacaggagctggagggcacatat
gaggagaacgagcgtgcactggagggcaaagcggcccagctggatgggctggaagccagg
atgcgcagtgtgctccaggccatcaacttgcaggtccagatctacaacacctgccagtga

KEGG   Mus musculus (mouse): 16780
Entry
16780             CDS       T01002                                 

Gene name
Lamb3
Definition
(RefSeq) laminin, beta 3
  KO
K06244  laminin, beta 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16780 (Lamb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16780 (Lamb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16780 (Lamb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16780 (Lamb3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16780 (Lamb3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16780 (Lamb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16780 (Lamb3)
   05145 Toxoplasmosis
    16780 (Lamb3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II F5_F8_type_C BNR_6
Other DBs
NCBI-GeneID: 16780
NCBI-ProteinID: NP_001264857
MGI: 99915
Ensembl: ENSMUSG00000026639
Vega: OTTMUSG00000025453
UniProt: Q61087
Position
1 H6; 1 97.71 cM
AA seq 1168 aa
MTAFFLLWLALPGFLCAQQACSRGACYPPVGDLLIGRTQLLRASSTCGLTKPETYCTQYG
QWQMKCCKCDSRLPRNYNSHRVENVASSSGPMRWWQSQNDVSPVSLQLDLDKRMQLQDIM
MDFKGLTPAGMLIERSSDFGKTWRVYQYLATDCASTFPQVHQGQPKNWQDVRCRPLSQRP
NGHLTGGKVQLNLMDLASAIPASQSKKIQELGDITNLRVNFTKLAPVPQRGSYPPSAYFA
VSQLRLQGSCFCHGHADRCAPNPGGSTTAVQVNNVCVCQHNTAGPNCDRCAPFYNNRPWR
PAEGQDTHECQRCDCNGHSETCHFDPAVFAASQGTNGGVCDNCRDHTEGKNCERCQLHYF
RNRRPSAPIHETCIPCECDPDGAVQGAPCDRLTGQCVCKEYVQGERCDLCKPGFTGLTFA
NPKGCHACDCSILGARKDMPCEEETGRCLCLPNVVGPKCDQCAPSHWKLASGLGCEPCAC
DPRNSLSSQCNQFTGQCPCREGFGGLTCSSAAIRQCPDQTYGHVATGCRACDCDFRGTEG
PGCDKASGRCLCRPGFTGPRCDQCQRGHCDRYPVCVACHSCFQAYDTDLQEQARRLHSLR
NATEGLWTGTGLEDHGLASRLLDAKSKIEQIRQILEGTSVTEQDVAQVANGILSIRRTLQ
GLPLDLPLEEEMESFSGDLGNLDRSFSRLLLMYRSKKEQFEKLSSEDPSGAFRMLTMAYE
QSSRAAQQVSDSSSLLSQLRDSRREAEGLERQAGGGGTGGAQLMALRLEMASLPDLTPTI
NKLCGRSRQTACTPGDCPGELCPQDNGTACGSHCRGALPRAKGAFHMAGRVAEQLRNFNT
QLQQTRQMIRAAEEAASRVQADAQRLETQVSTSRLLMEEDVQRTRLLIQQVRGFLTDPDT
DAATIQQVSEAVLALWLPTDSATVLRKMKEIQAIAARLPNVDSVLSQTKQDIARARRLQA
EAEQARSRAHAVEGQVDDVVGNLRQGTVALQEAQDTMQGTGRSLRLIQERVGEVQQVLVP
AERLVKGMKEQMSGFWARMKELRRQAQEEQAQAMQARQLAEGASQQAMNAQEGFKRLKQK
YTELKDRLGQSPVLGEQGNRILSIKMEAEELFGETMEMMDKMKDMESELLRGSQAIMLRS
ADLSGLEKRVEQIRSYINGRVLYYATCK
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgacagcatttttcctcctgtggcttgccttgcctggcttcctgtgtgcccagcaagcc
tgctcccgaggggcctgttatccacctgtgggggacttgctcattggaaggactcagctt
cttcgagcctcatctacctgtggattgaccaaacctgagacctattgcacccaatatgga
cagtggcagatgaaatgctgcaagtgtgactccaggctgcctcgaaattacaacagtcac
cgagtggagaatgtcgcatcgtcttcaggccccatgcgctggtggcagtcacagaatgat
gtgagccctgtctctctgcagctggacctagacaagaggatgcagcttcaggacatcatg
atggattttaagggtctcacaccagctggcatgttgattgagcgctcttctgactttggc
aagacatggagggtgtaccagtacctggcgacagactgtgccagcacctttccccaggtc
caccagggccagcccaagaactggcaggacgtccggtgccggcccttgtcccagaggcct
aatgggcatctgactgggggaaaggtccaacttaaccttatggatttagcatcagctatc
cctgcatctcaaagtaaaaagattcaagaacttggggacatcacaaacttgagagtcaac
ttcaccaagctggcccctgtgccccagaggggctcctatccacccagcgcctactttgca
gtgtcacagctacgtctacaggggagttgcttctgtcacggacatgccgaccgctgtgcc
cctaatcctggaggttctaccactgctgtgcaggtcaacaatgtctgtgtctgccagcat
aacacagctggccccaattgtgaccgctgtgcccctttctacaacaaccgtccatggaga
cctgcagagggccaggacacccacgagtgccaaaggtgtgactgcaatgggcactcagag
acctgccacttcgacccagctgtgtttgctgccagccaggggacaaatggaggtgtgtgt
gacaactgccgggaccacaccgagggcaagaactgcgagcgctgtcagctacactatttc
cggaatagacgacccagcgctcccattcatgagacttgtattccctgtgagtgtgatcca
gatggagcagtccagggagctccctgtgaccgactgacgggccagtgtgtgtgcaaagag
tacgtgcaaggagagcgctgcgacctttgcaagcctggcttcaccgggctcaccttcgcc
aacccgaagggctgccatgcctgtgactgcagtatcttaggtgcccggaaagatatgcct
tgtgaggaggaaaccggacgctgcttgtgtctgcccaatgtagtgggccccaaatgtgac
cagtgtgccccttcccactggaagctggccagcggcctgggctgcgagccctgtgcctgt
gaccctcgcaactccctaagctcccagtgcaaccagtttacaggacagtgtccttgtcgg
gaagggtttggcggcctcacgtgtagttctgcagccatccgccagtgtcctgaccagacc
tatggacacgtggccacagggtgccgagcttgtgactgtgacttcagaggaacagagggt
cctggctgtgacaaagcctcaggccgttgcctctgccgccctggctttaccgggccccgc
tgtgaccaatgccaacgaggtcactgtgaccgctacccagtatgtgtggcctgccactcc
tgcttccaggcctatgacacagacctccaggagcaagctcgacgccttcacagtctccgt
aatgccaccgaaggcctgtggacagggacaggtctggaagaccatggcctggcttctcgg
ttgctagatgccaagagcaagattgagcagatcagacagattctggaaggcacttctgtc
acagagcaggatgtggctcaggtggccaatggcatcttgtctatcaggagaactcttcag
ggcctgccgctggacctgcccttagaggaggagatggaatccttctctggagacctgggg
aatctagacagaagcttcagtcggctcctccttatgtaccgaagcaagaaggagcaattt
gagaagctaagcagtgaagacccttcaggagccttccgcatgctgaccatggcttatgag
cagtcctcccgggctgcacagcaagtgtctgacagttctagcctgctgagccagttgagg
gacagtcgcagggaagcagagggcctggagagacaggctggaggaggaggcaccggagga
gctcagctcatggccctgcgcctagaaatggcttcgctgcctgacttgacacccaccatc
aacaagctttgtggcaggtctaggcagacagcctgtactccaggagattgccctggagag
ctgtgtcctcaggacaatggtacagcttgtggctctcactgcaggggagccctgcccaga
gccaaaggggccttccacatggcagggcgggtagctgagcagctacgaaacttcaacacc
cagctccagcagaccaggcaaatgatcagggcagccgaggaagcagcatcaagggtccaa
gccgatgcccagcgccttgagacccaggtgagtaccagccgcttgctgatggaggaagat
gtccagcgcacacggcttctcatccaacaggtccggggctttctcacagatcctgacaca
gatgcagccaccatccaacaggtcagcgaggcagtgctggctctctggctgcccacagac
tcagccacagtgctgcgcaagatgaaagagatccaggccattgcggccaggctccctaat
gtggactcagtgctatcccagaccaaacaagacatcgcacgggcccgcaggctccaggct
gaggctgagcaggccagaagccgagcccacgctgtggaagggcaggtagatgatgtggtc
gggaaccttcggcagggcaccgtggctctgcaggaagctcaggacacaatgcagggtact
ggccgctctcttcggctcatccaggaaagggttggtgaggttcagcaggtccttgtacca
gctgaaaggctggtgaaaggcatgaaggaacagatgagtggattctgggcacggatgaag
gagcttcgccgtcaggcccaggaggagcaggcccaggcaatgcaggcccggcagcttgca
gagggtgccagccagcaggcaatgaatgcccaggagggctttaagagacttaagcaaaag
tatacagagttgaaggaccggctgggtcagagtcctgtgctgggcgagcaaggcaatcga
atcctgagcatcaagatggaggcagaggagctctttggggagaccatggaaatgatggac
aaaatgaaagacatggagtcagagctgcttcgagggagtcaggctatcatgctgcgctct
gcagacctgtcggggctggagaagcgtgtggagcagatccgcagttacatcaatgggcga
gtgctctactatgccacctgcaagtga

KEGG   Mus musculus (mouse): 16782
Entry
16782             CDS       T01002                                 

Gene name
Lamc2, AA589349
Definition
(RefSeq) laminin, gamma 2
  KO
K06246  laminin, gamma 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16782 (Lamc2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16782 (Lamc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16782 (Lamc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16782 (Lamc2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16782 (Lamc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16782 (Lamc2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16782 (Lamc2)
   05145 Toxoplasmosis
    16782 (Lamc2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B
Other DBs
NCBI-GeneID: 16782
NCBI-ProteinID: NP_032511
MGI: 99913
Ensembl: ENSMUSG00000026479
Vega: OTTMUSG00000049711
UniProt: G5E874
Position
1 G3; 1 65.26 cM
AA seq 1193 aa
MPALWLSCCLGVALLLPAAQATSRREVCDCNGKSRQCVFDQELHRQTGSGFRCLNCNDNT
AGVHCERCREGFYRHRDRDRCLPCNCHSKGSLSAGCDNSGQCRCKPGVTGQRCDRCQPGF
HMLTDAGCTRDQGQLDSKCDCDPAGISGPCDSGRCVCKPAVTGERCDRCRPGYYHLDRAN
PEGCTQCFCYGHSASCHASADFSVHKITSTFSQDVDGWKAVQRNGAPAKLHWSQRHRDVF
SSARRSDPVYFVAPAKFLGNQQVSYGQSLSFDYRVDRGGRQPSAYDVILEGAGLQIRAPL
MAPGKTLPCGITKTYTFRLNEHPSSHWSPQLSYFEYRRLLRNLTALLIRATYGEYSTGYI
DNVTLVSARPVSGAPAPWVERCVCPAGYKGQFCQECASGYKRDSARLGPFGACVPCNCQG
GGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPPGVTGARCELCADGFFGDPFGERGPVRPCQRCQCNNNVDPNASGNCDQLTGRCLK
CIYNTAGVYCDQCKAGYFGDPLAPNPADKCRACNCSPMGSEPGECRGDGSCVCKPGFGGL
NCDHAALTSCPACYNQVKIQMDQFTQQLQSLEALVSKAQGGGGGGTVPSGELEGRMQQAE
QALRDILREAQISEGAMRALGFRLAKARSQENDYKTRLDDLKMTAERIRALGSQHQNRVQ
DTSRLISQMRLSLAGSEASLQNTNIHSSEHYVGPNGFKSLAQEATRLADSHAESANAMKQ
LARETEDYSKQALSLARKALSGGGGSGVLDSSVVQGLMGKLEKTKSLSQQLSREGTQADI
EADRSYQHSLRLLDSASQLQGVSDLSFQVEAKRIRQKADSLSNLVTRQTDAFTRVRNNLG
NWEKETRQLLQTGKDRRQTSDQLLSRANLAKNRAQEALSMGNATFYEVENILKNLREFDL
QVEDRKAEAEEAMKRLSSISQKVADASDKTQQAETALGSATADTQRAKNAAREALEISSE
IEQEIGSLNLEANVTADGALAMEKGLATLKSEMREMEGELARKELEFDTDKDTVQLVITE
AQQADARATSAGVTIQDTLNTLDGILHLIDQPGSVDEEGMMLLEQGLFQAKTQINSRLRP
LMSDLEERVRRQRNHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctcagctgctgccttggtgtcgcgctcctgctgcccgcagcccag
gccacctccaggagggaagtctgtgattgcaatgggaagtccaggcaatgtgtctttgat
caggagctccatcgacagacaggcagcgggttccgttgcctcaactgcaatgacaataca
gcgggggttcactgcgagcggtgcagggaggggttttaccgacatcgagacagagaccgc
tgcctaccctgcaactgccactcaaagggttccctcagtgctggatgtgacaactctgga
caatgcaggtgtaagccaggtgtgacaggacaaagatgtgaccgatgtcagccaggcttc
catatgctcaccgatgctggatgcacccgagaccaggggcaactagattccaagtgtgac
tgtgacccagctggcatctctggaccctgtgattctggccgatgtgtctgcaaaccagcc
gtcactggagagcgctgtgataggtgccgaccaggctactatcatctggaccgggcaaac
cctgagggctgtacccagtgtttctgctatgggcattcagccagctgccacgcctctgcc
gacttcagtgtccacaaaatcacttcaactttcagtcaggatgtggatggttggaaggcg
gttcagagaaacggggcacctgcaaaactccactggtcacagcgccatcgggacgtgttt
agttctgcccgaagatcagaccccgtctatttcgtggcccctgccaaattcctcggtaac
cagcaagtgagttacgggcagagcctgtcttttgactaccgcgtggacagaggaggtaga
cagccgtctgcctacgatgtgatcctggaaggtgctggtctacagatcagagctcctctg
atggctccaggcaagacacttccctgtgggatcacaaagacttacacattcagactgaat
gaacatccaagcagtcactggagtccccagctgagttatttcgaatatcgaaggttactg
cggaacctcacagccctcctgatccgagctacgtacggagaatatagtacagggtacatt
gataacgtgaccctggtttcagcccgccctgtctctggagccccagccccttgggttgaa
cgttgtgtatgccctgctgggtacaagggacaattctgccaggaatgtgcttctggttac
aaaagagattcggcaagattggggccttttggcgcctgtgttccctgtaactgccaaggg
ggaggggcctgtgatccagacacgggagattgctactcgggggacgagaatcctgacatt
gagtgtgctgactgtcccatcggtttctacaatgacccacatgacccccgcagctgcaag
ccatgtccctgtcacaatgggttcagctgttcagtgatgcctgagacagaggaggtggtg
tgtaacaactgtccccctggggtcacaggtgcccgctgtgagctctgtgctgatggcttc
tttggggatccctttggggaacgtggcccagtgaggccttgtcaacgctgccaatgcaac
aacaacgtggaccccaatgcctctgggaactgtgaccagttgacaggcagatgcttgaaa
tgtatctacaacacggccggtgtctactgtgaccagtgcaaagcaggttactttggagac
ccattggctcccaacccagcagacaagtgtcgagcttgcaactgcagccccatgggctcg
gagcctggagagtgtcgaggtgatggcagctgtgtttgcaagccaggctttggcggcctc
aactgtgatcacgcagccctaaccagttgtcctgcttgctacaatcaagtgaagattcag
atggaccagtttacccagcagctccagagcctggaggccctggtttcaaaggctcagggt
ggtggtggtggtggtacagtccccagtggggagctggaaggcaggatgcagcaggctgag
caggcccttcgagacattctaagagaagctcagatttcagaaggggcaatgagagccctt
ggcttccggctggccaaggcaaggagccaagagaacgactacaagacccgcctggatgac
ctcaagatgactgcagaaaggatccgggccctgggcagtcagcatcagaacagagttcag
gatacgagcagactcatctctcagatgcgcctgagtctggcaggaagcgaagcttccctg
caaaacactaatatccattcttctgagcactacgtggggccgaatggatttaaaagtctg
gctcaggaggctacaagattggcagacagccacgctgagtcagctaacgcaatgaagcaa
ctagcaagggaaactgaggactactccaaacaagcactttcattggcccgcaaggctctg
agtggaggaggcggaagtggcgtcttggacagctccgtggtacaaggtcttatgggaaaa
ttagagaaaaccaagtccctgagccagcagctgtcaagggagggcacccaagccgacatt
gaagctgataggtcgtatcagcacagtctccgcctcctggattctgcctctcagcttcag
ggagtcagtgatctgtcctttcaggtggaagcaaagaggatcagacaaaaggctgattct
ctctcaaacctggtgaccagacaaacggatgcattcacgcgtgtgcgaaacaatctgggg
aactgggaaaaagaaacacggcagcttttacagactggaaaggataggagacagacttca
gatcagctgctttcccgtgccaaccttgctaaaaacagagcccaagaagcgctaagtatg
ggcaatgccactttttatgaagttgagaacatcctgaagaacctccgagagtttgatctg
caggttgaagacagaaaagcagaggctgaagaggccatgaagagactctcctctattagc
cagaaggttgcagatgccagtgacaagacccagcaagcagaaacggccctggggagcgcc
actgccgacacccaacgggcaaagaacgcagctagggaggccctggagatcagcagcgag
atagagcaggagatagggagtctgaacttggaagctaatgtgacagcagatggggccttg
gccatggagaagggactggccactctgaagagcgagatgagagagatggagggggagctg
gccagaaaggagctggagtttgacacggataaggacacggtgcagctggtgattactgaa
gcccagcaagctgatgccagagccacgagtgccggagttaccatccaagacacactcaac
acattggacggcatcctacacctcatagaccagcctggcagtgtggatgaagaagggatg
atgctattagaacaagggcttttccaagccaagacccagatcaacagtcgacttcggccc
ttgatgtctgacctggaggagagggtgcgtcggcagaggaaccacctccatctgctggag
accagcatagatggaattctagctgatgtgaagaacctggagaacattcgagacaacctg
cccccaggctgctacaatacccaagctcttgagcaacagtga

KEGG   Mus musculus (mouse): 19699
Entry
19699             CDS       T01002                                 

Gene name
Reln, reeler, rl
Definition
(RefSeq) reelin
  KO
K06249  reelin [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05017  Spinocerebellar ataxia
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    19699 (Reln)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    19699 (Reln)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19699 (Reln)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    19699 (Reln)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    19699 (Reln)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     19699 (Reln)
SSDB
Motif
Pfam: BNR EGF_2 Reeler EGF_Tenascin hEGF EB
Other DBs
NCBI-GeneID: 19699
NCBI-ProteinID: NP_035391
MGI: 103022
Ensembl: ENSMUSG00000042453
Vega: OTTMUSG00000030584
UniProt: Q60841
Structure
PDB: 
6A48 2E26 2DDU 3A7Q 5B4X

Position
5 A3; 5 9.98 cM
AA seq 3461 aa
MERGCWAPRALVLAVLLLLATLRARAATGYYPRFSPFFFLCTHHGELEGDGEQGEVLISL
HIAGNPTYYVPGQEYHVTISTSTFFDGLLVTGLYTSTSIQSSQSIGGSSAFGFGIMSDHQ
FGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLCE
QGAPTEATAYSHLAEIHSDSVILRDDFDSYQQLELNPNIWVECSNCEMGEQCGTIMHGNA
VTFCEPYGPRELTTTCLNTTTASVLQFSIGSGSCRFSYSDPSITVSYAKNNTADWIQLEK
IRAPSNVSTVIHILYLPEEAKGESVQFQWKQDSLRVGEVYEACWALDNILVINSAHREVV
LEDNLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQ
WSEEFESQPTGWDILGAVVGADCGTVESGLSLVFLKDGERKLCTPYMDTTGYGNLRFYFV
MGGICDPGVSHENDIILYAKIEGRKEHIALDTLTYSSYKVPSLVSVVINPELQTPATKFC
LRQKSHQGYNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNSVSLEFSTNHGR
SWSLLHTECLPEICAGPHLPHSTVYSSENYSGWNRITIPLPNAALTRDTRIRWRQTGPIL
GNMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPACEMASQTFPMFISESFGSAR
LSSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTLRLGSK
SVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYVNYHEPRIISVELPDDARQFGIQF
RWWQPYHSSQGEDVWAIDEIVMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWT
LCFTGDSKLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSANHGLT
WHLVQEECLPSMPSCQEFTSASIYHASEFTQWRRVTVVLPQKTWSGATRFRWSQSYYTAQ
DEWALDNIYIGQQCPNMCSGHGSCDHGVCRCDQGYQGTECHPEAALPSTIMSDFENPSSW
ESDWQEVIGGEVVKPEQGCGVVSSGSSLYFSKAGKRQLVSWDLDTSWVDFVQFYIQIGGE
SAACNKPDSREEGILLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAAKTPCTRFRW
WQPVFSGEDYDQWAVDDIIILSEKQKQVIPVVNPTLPQNFYEKPAFDYPMNQMSVWLMLA
NEGMAKNDSFCATTPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCTSQFSSTAPV
LLQYSHDAGMSWFLVKEGCFPASAGKGCEGNSRELSEPTVYYTGDFEEWTRITIAIPRSL
ASSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCISGVCFCDLGYTAAQGT
CVSNTPNHSEMFDRFEGKLSPLWYKITGGQVGTGCGTLNDGRSLYFNGLGKREARTVPLD
TRNIRLVQFYIQIGSKTSGITCIKPRARNEGLVVQYSNDNGILWHLLRELDFMSFLEPQI
ISIDLPREAKTPATAFRWWQPQHGKHSAQWALDDVLIGVNDSSQTGFQDKFDGSIDLQAN
WYRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASSFLQFEMNMGCSKPFSGA
HGIQLQYSLNNGKDWQLVTEECVPPTIGCVHYTESSTYTSERFQNWRRVTVYLPLATNSP
RTRFRWIQTNYTVGADSWAIDNVILASGCPWMCSGRGICDSGRCVCDRGFGGPFCVPVVP
LPSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTCLIFKGEGLRMLISRDLDCTNT
MYVQFSLRFIAKGTPERSHSILLQFSVSGGVTWHLMDEFYFPQTTSILFINVPLPYGAQT
NATRFRLWQPYNNGKKEEIWIIDDFIIDGNNLNNPVLLLDTFDFGPREDNWFFYPGGNIG
LYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLSVNENTIIQFEINVGCSTDSSSADPV
RLEFSRDFGATWHLLLPLCYHSSSLVSSLCSTEHHPSSTYYAGTTQGWRREVVHFGKLHL
CGSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCYGHGSCINGTKCICDPGYSGPTC
KISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLVTRDLD
LSHARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIALE
MPLKARSGSTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTVLEDDFSTLDSRKWLLHP
GGTKMPVCGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDFAASCSVTDSCYAIELEY
SVDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPSYTRSQATRFRWH
QPAPFDKQQTWAIDNVYIGDGCLDMCSGHGRCVQGSCVCDEQWGGLYCDEPETSLPTQLK
DNFNRAPSNQNWLTVSGGKLSTVCGAVASGLALHFSGGCSRLLVTVDLNLTNAEFIQFYF
MYGCLITPSNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNILLPPDAKEIATRFR
WWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRIAFEM
FLEDKTSVNENWLFHDDCTVERFCDSPDGVMLCGSHDGREVYAVTHDLTPTENWIMQFKI
SVGCKVPEKIAQNQIHVQFSTDFGVSWSYLVPQCLPADPKCSGSVSQPSVFFPTEGWKRI
TYPLPESLTGNPVRFRFYQKYSDVQWAIDNFYLGPGCLDNCGGHGDCLKEQCICDPGYSG
PNCYLTHSLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGVLAENTALYFGGSTVRQAIT
QDLDLRGAKFLQYWGRIGSENNMTSCHRPVCRKEGVLLDFSTDGGITWTLLHEMDFQKYI
SVRHDYILLPEGALTNTTRLRWWQPFVISNGLVVSGVERAQWALDNILIGGAEINPSQLV
DTFDDEGSSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYM
MQFKIVVGCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQFHEATI
YNAVNSSSWKRITIQLPDHVSSSATQFRWIQKGEETEKQSWAIDHVYIGEACPKLCSGHG
YCTTGAVCICDESFQGDDCSVFSHELPSYIKDNFESARVTEANWETIQGGVIGSGCGQLA
PYAHGDSLYFNGCQIRQAATKPLDLTRASKIMFVLQIGSPAQTDSCNSDLSGPHTVDKAV
LLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQWA
LDHVEVVLVSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP
NT seq 10386 nt   +upstreamnt  +downstreamnt
atggagcgcggctgctgggcgccgcgggctctcgtcctggccgtgctgctgctgctggcg
acgctgagggcgcgcgcggccaccggctactacccgcgcttctcgcctttctttttcctg
tgcacccaccacggggagctggaaggggatggggagcagggcgaggtgctcatttccctg
cacattgcgggcaaccccacctactacgtaccgggacaggaataccatgttacaatttca
acaagcaccttctttgatggcttgctggtgacgggactctatacctcgacaagcatccag
tcttctcagagcattggaggctccagcgcctttggattcgggatcatgtccgaccaccag
tttggtaaccagtttatgtgcagtgtggtggcctctcatgtgagtcacctgcctacaacc
aacctcagctttgtctggattgccccaccagctggcacaggctgtgtgaatttcatggct
actgcaacacataggggccaggtgattttcaaagacgcactggcccagcagctgtgtgaa
caaggagctcccacagaggccactgcttactcgcaccttgctgaaatacacagtgacagt
gtgatcctacgagatgactttgactcctaccagcaactggaattgaaccccaacatatgg
gttgaatgcagcaactgtgagatgggagagcagtgtggcaccatcatgcatggcaatgct
gtcaccttctgtgagccgtacggccctcgagagctgaccaccacatgcctgaacacaaca
acagcatctgtcctccagttttccattgggtcaggatcatgtcgatttagttactctgac
cccagcatcactgtgtcatacgccaagaacaataccgctgattggattcagctggagaaa
attagagccccttccaatgtgagcacagtcatccacatcctgtacctccccgaggaagcc
aaaggggagagcgtgcagttccagtggaaacaggacagcctgcgagtgggtgaggtgtat
gaggcctgctgggccctggataacatcctggtcatcaattcagcccacagagaagtcgtt
ctggaggacaacctcgacccggtcgacacgggcaactggctcttcttccctggagcaacg
gtcaagcatagctgtcagtcagatgggaactccatttatttccatggaaatgaaggcagc
gagttcaattttgccaccacccgggatgtagatctttctacagaggatattcaagagcag
tggtcagaagaatttgagagccagcccacaggatgggatatcttgggagcagtagttggt
gcagactgtggaaccgtagaatcaggactatcactggtgttcctcaaagatggagagagg
aagctttgcaccccctacatggatacaactggttatggcaacctgaggttctacttcgtt
atgggaggaatctgtgaccctggagtctctcatgaaaacgatatcatcttatatgcaaag
attgaaggaagaaaagaacacattgcactggacactcttacctattcttcctataaggtt
ccgtctttggtttctgtggtcatcaaccctgaacttcagacacctgccaccaaattttgt
ctcaggcaaaagagccaccaagggtataatcggaatgtctgggctgtggacttcttccat
gtgctgcccgttctcccttcaacaatgtctcacatgatccagttttctattaatttggga
tgcggcacacaccagcctgggaacagcgtcagcttggagttttctactaaccatggacgg
tcctggtccctactccacactgagtgcttgccggagatctgtgcaggcccccacctcccc
cacagcactgtctactcctcagaaaactacagcgggtggaaccgaatcacgattcctctc
cctaatgcagcactcacccgagacaccaggattcgctggagacaaacaggcccaatcctg
ggaaatatgtgggcaattgataatgtttatataggtccttcgtgtctcaaattctgttct
ggcagaggacaatgcactcggcatggctgcaagtgtgacccaggattttctggcccagct
tgtgagatggcatctcagacattcccaatgtttatttcggaaagctttggcagtgccaga
ctttcctcttaccataacttttactctatccgtggtgctgaagtcagctttggttgtggt
gtcttagccagtggtaaggctctggttttcaacaaagatgggaggcggcagctaatcacg
tcctttctggacagctcgcagtccaggtttcttcagtttacactgaggctggggagcaag
tctgtgctgagcacgtgcagagcccctgaccagccgggggagggagtcctgctgcactat
tcatatgacaacgggataacatggaaactcctggagcactattcctacgtcaactaccac
gagcccagaataatctctgtagagctaccggatgatgcaagacagtttggaatccagttc
agatggtggcagccttaccattcttcccaaggagaagacgtgtgggccattgatgagatt
gtcatgacctcagtcctgttcaacagcatcagtctcgactttaccaatcttgtggaagtc
actcaatccctgggattctaccttggcaatgttcaaccatactgtggccatgactggacg
ctttgttttacgggagattctaaacttgcctcaagcatgcgctatgtggaaacacagtcc
atgcagatcggagcatcctatatgattcagttcagcctagtgatgggatgtggccagaaa
tacactcctcacatggacaaccaggtgaagctggagtactcagccaaccacggccttaca
tggcaccttgtacaagaagaatgccttcccagtatgccaagctgccaggaatttacatct
gccagcatttaccatgccagcgagttcacacagtggagaagagtcactgttgttcttccc
cagaaaacatggtccggtgccacccgcttccgttggagtcagagctattacacagcccag
gatgagtgggctttagacaacatttacattgggcagcagtgccccaacatgtgcagtggg
catggctcatgtgaccatggcgtgtgcaggtgtgaccagggataccagggcactgaatgc
cacccagaagctgcacttccttccacgattatgtcagattttgagaacccgagcagttgg
gaatcagactggcaggaagttattgggggagaagttgtaaagcctgagcaaggctgtgga
gtcgtgtcttctggatcttctctgtacttcagcaaggctgggaagaggcagctggtgagc
tgggacctggacacatcctgggtggactttgtccagttctacatccagataggaggagag
agtgctgcatgcaacaagcctgacagcagagaggagggcattctgctccagtatagcaac
aacgggggcatccagtggcacctgctggcagagatgtacttctcagacttcagcaaaccc
agatttgtctacctggagctcccagctgctgcgaagaccccttgtaccaggttccgctgg
tggcagcctgtgttctcgggggaggactatgaccagtgggccgttgatgatatcatcatt
ctgtcagagaagcagaagcaggttattccagttgtcaacccaactttgccccagaacttc
tatgagaagccagctttcgattaccctatgaaccaaatgagtgtgtggctaatgttggcc
aatgaaggcatggctaaaaacgacagcttctgtgcgaccacgccgtcagccatggtgttt
ggaaagtcagatggagaccggtttgcagtaactcgagatctgaccctgaaacctggatat
gtgctgcagttcaagctaaacataggctgcaccagccagttcagcagcactgccccggtt
ctcctgcagtattcacatgatgccggcatgtcgtggtttctggtgaaggaaggatgcttc
ccagcgtcagcaggcaaaggatgtgaagggaactccagggaattgagtgagcctactgtc
tattatactggggacttcgaagaatggactagaatcaccattgccattccaaggtccctt
gcatccagcaagaccagattccgatggatccaagagagcagctctcagaagaatgtgccc
ccgtttggcttagatggggtgtacatatctgagccttgtcccagttactgcagtggccat
ggagactgcatctcgggggtgtgtttttgtgacctggggtacacagctgcacaaggaacc
tgtgtgtcaaacacccctaaccacagtgagatgttcgacaggtttgaggggaagctaagc
ccactgtggtacaaaatcaccgggggtcaggttggcacgggctgtggcaccctcaatgac
ggcaggtccctctactttaatggccttgggaaaagggaagccaggacagtcccactggac
accaggaatatcagacttgttcagttttatatacaaattggaagtaaaacatcagggatt
acgtgcatcaaaccacgggctagaaatgaggggcttgttgttcagtattccaatgataat
gggatactttggcatttgctgagagagttggatttcatgtcattcctggagccacagatc
atttccattgacctgccccgggaagcaaagacacctgccacagctttccggtggtggcag
ccgcagcatgggaagcattcggcccagtgggctttggatgatgtccttataggagtgaat
gacagctctcaaactggatttcaagataaatttgatggctccatagacttgcaagccaac
tggtatcgaatccagggaggccaagttgatatcgactgcctctctatggacactgccctt
atattcactgaaaacataggaaaacctcgctatgctgagacctgggacttccatgtgtca
gcgtcaagcttcttacagtttgaaatgaacatgggctgcagcaagcctttcagtggtgcc
cacggcatacagctccagtactctctgaacaacggcaaggactggcagcttgtcaccgaa
gagtgtgtccctccaaccattggctgcgtgcactacacagagagttcaacttacacatca
gaaagattccagaactggaggcgggtcacggtctacctgccactcgccaccaattctccc
aggactcggttcagatggattcagaccaactatactgttggagcagattcctgggctatt
gataatgtcatcctggcctcgggctgtccttggatgtgctcaggacgagggatctgtgat
tcggggcgctgtgtgtgtgaccggggcttcggtggacccttctgtgttcctgttgttcct
cttccctccattctaaaagatgatttcaatgggaacttacatcctgacctttggcctgaa
gtgtacggggcagagaggggcaatctgaatggcgaaaccatcaaatccggaacatgtctg
atctttaaaggggagggactaagaatgcttatttccagagatctagattgcaccaatact
atgtatgtccagttctctctccgatttatagcgaaaggtaccccagagaggtctcactcc
atccttctacagttctctgtcagtggaggagtcacctggcacctgatggatgaattctac
ttccctcaaacgaccagcatacttttcatcaatgttcccttaccatacggtgcccaaacc
aacgctacaagattcagactctggcaaccgtacaataatggtaagaaagaagaaatctgg
atcattgatgactttattattgatggaaacaatttgaacaaccccgtgctgctgctggac
acgttcgactttgggcccagggaagacaattggtttttctatccgggtggtaatatcgga
ctttactgcccgtattcttcaaagggagctcctgaggaggattcggccatggtgtttgtt
tcaaacgaagttggagaacactccattaccacacgagacctaagtgtgaacgagaacacc
atcattcaatttgagatcaatgttggctgctccactgatagttcttctgctgatccggtc
agactggaattctcaagggactttggagccacctggcacctgctgctgcctctctgctac
cacagcagcagcctcgtcagctccttatgctccactgagcatcacccgagcagcacctac
tacgcggggaccacccagggctggcggcgggaggtcgtgcacttcggaaagctgcacctt
tgtggatctgtgcgtttccgttggtaccagggattttatcctgctggctctcagccggtc
acatgggccattgacaatgtctacattggtccccagtgtgaagagatgtgctatgggcac
gggagctgcatcaatggaaccaagtgtatatgtgacccgggctactctgggccaacctgt
aaaataagcaccaaaaatcctgattttctcaaagacgactttgaaggtcaactggaatcc
gatcgattcttactgatgagcggtgggaagccgtctcgtaagtgtggcatcctttccagt
gggaacaacctcttcttcaatgaggacggcttgcgcatgctagtaacacgggacctggat
ttatcacatgcaaggtttgtgcagttcttcatgagactgggatgtggtaaaggtgttcca
gaccccaggagccagcccgtgcttctgcagtactccctcaatggcggcctctcctggagt
cttcttcaagagttcctcttcagcaactccagcaatgtgggcaggtacattgccctggaa
atgcccctgaaagcccgttctggttcgacacgcctccgctggtggcagccatctgaaaat
gggcacttctatagcccctgggtgatcgaccagattcttattggaggaaatatctctggt
aatacagtcttagaagatgatttctcaactctggacagcagaaagtggctgcttcaccca
ggaggcaccaagatgcctgtgtgtggctccacaggcgatgccctggtctttattgaaaag
gccagcacccgttacgtggtcacgacagacatcgctgtgaatgaggactcattcctacag
atagactttgctgcctcctgctcagtcacagactcctgctatgctattgaactggagtac
tcggtggatctcggtctgtcgtggcacccgctggtgagggactgcctgcctaccaatgtt
gagtgtagtcgttaccacctgcagcggatcctggtgtcagatactttcaacaagtggacc
agaatcactctgcccctgccttcctacaccaggtctcaagccactcgtttccgctggcat
cagccagcgccttttgacaagcagcagacctgggcaatagataatgtctatattggggat
ggttgcctagacatgtgcagtggccacgggagatgcgtccagggaagctgtgtctgtgat
gaacagtggggaggcctgtactgtgatgagcctgagacctcccttcccacccagctcaaa
gacaacttcaaccgagccccctccaaccagaactggctgactgtgagcggtgggaagctg
agtacagtgtgtggggctgtggcttccggcctggctctccatttcagtgggggctgcagc
cgattgttagtcactgtggatctgaacctcaccaatgctgagtttatccagttttacttt
atgtatggatgcctcattacgccgagcaaccgtaaccagggagtcctgctggagtactct
gtcaatggaggcatcacctggaacttgctgatggagattttctatgaccagtacagcaaa
cctggatttgtgaatatccttctccctcctgatgctaaagagattgccactcgcttccga
tggtggcagccacgacatgatggccttgaccagaatgactgggccattgacaatgtcctc
atctcgggctctgcggaccagaggacagtcatgctggacacctttagcagcgccccagta
ccacagcatgagcgctcccccgcagacgctggccctgttggaagaattgcttttgaaatg
ttcttagaagacaaaacttcagtgaatgagaattggctcttccatgatgactgtacagtg
gaaagattctgtgactcgccagatggtgtcatgctctgtggcagccatgatggacgagag
gtgtatgcagtgactcatgacctgacgcccactgagaactggatcatgcagttcaagatc
tctgttggatgcaaagtgcctgaaaaaattgcccagaatcaaattcacgtgcagttttct
actgactttggcgtgagctggagttatttagtccctcagtgcttacccgccgacccaaag
tgttctggaagcgtttctcaaccgtctgtgttcttcccaactgaagggtggaaaaggatc
acctacccgcttcctgaaagcttaacggggaatcctgtaagatttaggttctaccaaaag
tactcagatgtgcagtgggcaattgacaatttctaccttggccctggatgtttggacaac
tgtggaggccacggagactgcctaaaggaacagtgtatctgtgacccaggctactcaggg
ccaaactgctacttaactcacagcctgaagactttcctgaaggagcgctttgacagtgag
gagatcaagcctgacttatggatgtccttggaaggcggaagcacttgtacagagtgcggg
gtcctcgccgagaacactgcactctattttgggggatccactgtgagacaagctattact
caagacttagatctcagaggtgcaaaattcctgcagtactggggacgtatcggcagtgag
aacaacatgacatcttgccatcggcctgtctgccggaaggaaggcgtgctgctggacttc
tctacggatggaggaatcacttggaccttgcttcacgagatggatttccagaaatacatt
tctgtgaggcacgactacatcctcctgcctgagggggccctcaccaacacaactcgactt
cgctggtggcagccttttgtcatcagcaatgggctcgtggtttccggggtggagcgtgcg
cagtgggcactggacaacattctgattggtggagcagaaatcaatccaagccaactggtg
gacactttcgatgacgaaggctcctcccatgaagaaaactggagtttttaccctaatgca
gtaaggacagcaggattctgtggcaacccatccttccacctctactggccaaataaaaag
aaggacaagacccacaatgcactctcctcccgagagctcattatacagccaggatacatg
atgcaatttaaaattgtggtgggttgtgaagccacttcatgtggtgaccttcattccgtg
atgctggagtacaccaaggatgcaaggtccgattcctggcagctcgtgcagacccagtgc
ctaccttcctcttccaatagcattggctgctccccgttccagttccatgaagccaccatt
tataatgctgtcaacagctcaagctggaagaggatcaccatccagctcccagaccacgtc
tcgtcaagtgccacacagttccgctggatccagaagggagaagaaaccgagaagcaaagc
tgggccatcgaccacgtgtacatcggagaggcttgtcccaagctctgcagcgggcatggc
tactgcaccacaggggccgtctgcatctgcgatgaaagcttccaaggtgacgactgctct
gtcttcagtcacgagcttcctagttacattaaagataattttgaatcagcaagagtcact
gaagccaactgggaaaccatccagggtggagtgatcggaagtggctgtgggcagctggcg
ccctatgcccatggagattcgctctactttaatggttgtcagataaggcaagctgccacc
aagccactggacctcactcgagcaagcaaaattatgtttgtcttgcaaattgggagccca
gcccagacagacagttgcaacagcgacctcagcggcccccacaccgtggacaaagcagta
ctgctgcagtacagtgtcaacaatggcatcacctggcacgtcatcgctcagcaccagccg
aaggacttcacacaagctcagcgggtgtcttacaacgtccccctggaagctcggatgaaa
ggagttctactgcgctggtggcagccacgccacaatggaacaggtcatgatcaatgggct
ttggaccatgtggaggtcgtcctagtaagcactcgcaaacaaaattacatgatgaatttt
tcacggcaacatgggctcaggcacttctacaacagaagacgaaggtcgcttaggcgatac
ccatga

KEGG   Mus musculus (mouse): 20750
Entry
20750             CDS       T01002                                 

Gene name
Spp1, 2AR, Ap, Apl-1, B, BNSP, BSPI, Bsp, ETA-, ETA-1, Eta, OP, Opn, Opnl, R, Ric, Sp, Spp-1, mi, ost
Definition
(RefSeq) secreted phosphoprotein 1
  KO
K06250  secreted phosphoprotein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04620  Toll-like receptor signaling pathway
mmu04929  GnRH secretion
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20750 (Spp1)
   04151 PI3K-Akt signaling pathway
    20750 (Spp1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    20750 (Spp1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    20750 (Spp1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    20750 (Spp1)
  09152 Endocrine system
   04929 GnRH secretion
    20750 (Spp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    20750 (Spp1)
SSDB
Motif
Pfam: Osteopontin
Other DBs
NCBI-GeneID: 20750
NCBI-ProteinID: NP_001191162
MGI: 98389
Ensembl: ENSMUSG00000029304
Vega: OTTMUSG00000024389
UniProt: P10923 Q547B5
Position
5 E5; 5 50.68 cM
AA seq 294 aa
MRLAVICFCLFGIASSLPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAV
SSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDE
TVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKS
GESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDV
IDSQASSKASLEHQSHKFHSHKDKLVLDPKSKEDDRYLKFRISHELESSSSEVN
NT seq 885 nt   +upstreamnt  +downstreamnt
atgagattggcagtgatttgcttttgcctgtttggcattgcctcctccctcccggtgaaa
gtgactgattctggcagctcagaggagaagctttacagcctgcacccagatcctatagcc
acatggctggtgcctgacccatctcagaagcagaatctccttgcgccacagaatgctgtg
tcctctgaagaaaaggatgactttaagcaagaaactcttccaagcaattccaatgaaagc
catgaccacatggacgacgatgatgacgatgatgatgacgatggagaccatgcagagagc
gaggattctgtggactcggatgaatctgacgaatctcaccattcggatgagtctgatgag
accgtcactgctagtacacaagcagacactttcactccaatcgtccctacagtcgatgtc
cccaacggccgaggtgatagcttggcttatggactgaggtcaaagtctaggagtttccag
gtttctgatgaacagtatcctgatgccacagatgaggacctcacctctcacatgaagagc
ggtgagtctaaggagtccctcgatgtcatccctgttgcccagcttctgagcatgccctct
gatcaggacaacaacggaaagggcagccatgagtcaagtcagctggatgaaccaagtctg
gaaacacacagacttgagcattccaaagagagccaggagagtgccgatcagtcggatgtg
atcgatagtcaagcaagttccaaagccagcctggaacatcagagccacaagtttcacagc
cacaaggacaagctagtcctagaccctaagagtaaggaagatgataggtatctgaaattc
cgaatttctcatgaattagagagttcatcttctgaggtcaactaa

KEGG   Mus musculus (mouse): 21825
Entry
21825             CDS       T01002                                 

Gene name
Thbs1, TS, TSP, TSP-1, TSP1, Thbs-, Thbs-1, tbs, tbsp1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04115  p53 signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    21825 (Thbs1)
   04350 TGF-beta signaling pathway
    21825 (Thbs1)
   04151 PI3K-Akt signaling pathway
    21825 (Thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21825 (Thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21825 (Thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    21825 (Thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21825 (Thbs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21825 (Thbs1)
   05205 Proteoglycans in cancer
    21825 (Thbs1)
  09162 Cancer: specific types
   05219 Bladder cancer
    21825 (Thbs1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21825 (Thbs1)
  09174 Infectious disease: parasitic
   05144 Malaria
    21825 (Thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21825 (Thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21825 (Thbs1)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21825 (Thbs1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21825 (Thbs1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21825 (Thbs1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   21825 (Thbs1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC cEGF EGF_3 TSP1_ADAMTS EGF_CA Laminin_G_3 Laminin_G_2 TSP1_CCN EGF Laminin_G_1
Other DBs
NCBI-GeneID: 21825
NCBI-ProteinID: NP_001300843
MGI: 98737
Ensembl: ENSMUSG00000040152
Vega: OTTMUSG00000015240
UniProt: Q80YQ1 Q3TR40
Position
2 E5; 2 59.34 cM
AA seq 1170 aa
MELLRGLGVLFLLHMCGSNRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFR
IENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNTGQIFSVV
SNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELD
VPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSSMVLELKGLRTIVTTLQDSIRK
VTEENRELVSELKRPPLCFHNGVQYKNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQV
CNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDKNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDLIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENFDISETDFRQF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDMKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggagctcctgcggggactaggtgtcctgttcctgttgcatatgtgtggaagcaaccgc
attccagagtctgggggagataacggtgtgtttgacatctttgaactcattggaggtgca
cgaaggggccccggtcgccgactggtgaagggccaagatctatccagccccgccttccgc
attgagaatgccaacctgatccccgctgtgccggatgacaagttccaagacctactggac
gctgtgtgggccgacaaaggcttcatcttcctggcttccttgaggcagatgaagaagacc
cggggcacactcctggctgtggaacggaaagacaacactggccagatcttcagtgtggtc
tccaacggcaaagctggcaccctggacctgagcctgagcctgccagggaagcaacaagtg
gtgtcagtggaggaagctctcctggccactggccagtggaagagcatcacgctgtttgtt
caagaggaccgggctcaactctacatagactgtgataagatggagagcgcggagctggat
gtacccatccagagcatcttcaccagggatctggccagcgttgccaggctccgagttgca
aagggagatgtcaatgacaattttcagggggtgctgcagaatgtgaggtttgtctttgga
accaccccagaagacattctcaggaacaaaggctgctccagctctaccaacgtccttctt
acccttgacaacaacgtggtgaacggttccagccctgctatccgcaccaactacatcggc
cacaaaacaaaggacctccaagctatctgtggcctctcctgtgatgaactatccagcatg
gtcctggaactgaagggcctgcgcaccatcgtgaccactctgcaggacagcatccgaaaa
gtgacggaagagaacagagagctggtcagtgagctgaagcggcctcccctctgctttcac
aatggagtccagtacaagaacaacgaggagtggactgtagacagttgcacagagtgtcac
tgccagaactcggttaccatctgcaaaaaggtgtcctgtcccatcatgccctgctccaac
gccacagttcctgatggtgaatgctgcccacggtgctggcccagcgactctgctgacgat
ggctggtctccctggtctgagtggacctcctgctctgccacatgtggcaatggaattcag
caacgtggtcgttcctgtgacagcctcaacaacagatgcgagggctcttcggtacagaca
aggacctgccacattcaggagtgtgacaaaagatttaaacaggatggtggctggagtcac
tggtctccatggtcgtcctgttctgtgacctgtggtgacggtgtgatcacaaggatccgg
ctctgcaactcccccagcccccagatgaacgggaagccctgtgaaggtgaagcccgggag
accaaagcctgcaagaaagacgcctgcccaattaatggaggctggggtccctggtcacca
tgggacatctgctctgtcacctgtggaggaggagtgcagagacgcagccgactctgtaac
aaccccacaccccagtttggaggcaaagactgtgttggcgatgtgacagaaaatcaagtt
tgcaacaagcaggactgcccaattgatggatgcctgtccaatccctgctttgctggtgcc
aagtgtactagctaccctgatggtagctggaaatgtggtgcgtgtcctcctggctacagt
ggaaatggcatccagtgcaaagacgtcgatgagtgcaaagaagtgcctgatgcttgcttc
aatcacaacggagaacatcggtgcaagaacacagatcctggctacaactgcctgccctgc
ccaccacgattcactggctcacagcccttcggccgaggtgtcgaacatgccatggccaac
aaacaggtgtgcaaaccgcgaaacccctgcacggacgggacgcatgactgcaacaagaac
gctaagtgcaactacctgggtcactacagtgaccccatgtaccgctgtgagtgcaagccc
ggctatgcaggcaatggcatcatctgcggagaggacacagacctggacggctggcctaat
gaaaacctggtgtgtgtggccaacgcaacctaccactgcaaaaaggacaactgccccaac
cttcccaactcggggcaggaagactatgacaaggacgggattggcgatgcctgcgatgat
gacgatgacaacgacaagatccccgatgacagggacaactgtccattccattacaaccca
gcccagtatgactatgacagagatgatgtgggagaccgctgtgacaactgcccctacaac
cacaaccctgaccaagcagacacagacaaaaacggggagggcgatgcctgtgctgtggac
atcgatggagatggaatcctcaatgaacgagacaactgccagtacgtttacaacgtggac
cagagggacacggacatggatggggttggagatcagtgtgacaactgccccctggaacac
aatccagaccagctggactctgactcagacctcataggggacacttgtgacaacaatcag
gacatcgatgaggatggccatcagaacaatctggacaactgtccctatgtgcctaatgcc
aaccaggccgaccatgataaagatggcaaaggagatgcctgtgaccatgacgatgacaat
gacggcatccctgatgacagagacaactgcaggctggtgcccaatcctgaccagaaggac
tctgatggtgatggccgaggtgacgcctgcaaagacgactttgaccatgacaatgtgcca
gatattgatgacatctgtcctgagaattttgacatcagtgaaaccgatttccgacaattc
cagatgattcctctagatcccaaaggaacctcccaaaatgaccctaactgggttgtccgc
catcagggcaaagaacttgtccagactgtaaactgtgaccctggacttgctgtaggttat
gatgagtttaatgctgtggacttcagcggtaccttcttcatcaacaccgagagagatgat
gactacgctggctttgttttcggctaccagtccagcagccgcttctacgttgtgatgtgg
aaacaagtcacccagtcctactgggacaccaaccccacaagggctcagggatactcaggc
ctgtctgtaaaggttgtgaactccaccaccggccctggcgagcacctgcggaatgcactg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgccacatc
ggctggaaagatttcactgcatacagatggcgtctcagccacaggccaaagaccggttat
atcagagtggtgatgtatgaaggaaagaaaatcatggctgactcgggacccatctatgac
aaaacctacgccggcggtagactaggcctgttcgtcttctctcaggaaatggtgttcttc
tcagacatgaaatacgagtgtcgagattcctaa

KEGG   Mus musculus (mouse): 21826
Entry
21826             CDS       T01002                                 

Gene name
Thbs2, TS, TSP2, Thbs-, Thbs-2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21826 (Thbs2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21826 (Thbs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21826 (Thbs2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21826 (Thbs2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21826 (Thbs2)
  09174 Infectious disease: parasitic
   05144 Malaria
    21826 (Thbs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21826 (Thbs2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21826 (Thbs2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21826 (Thbs2)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21826 (Thbs2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21826 (Thbs2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21826 (Thbs2)
  Exosomal proteins of colorectal cancer cells
   21826 (Thbs2)
  Exosomal proteins of bladder cancer cells
   21826 (Thbs2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21826 (Thbs2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   21826 (Thbs2)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS Laminin_G_3 EGF cEGF TSP1_CCN
Other DBs
NCBI-GeneID: 21826
NCBI-ProteinID: NP_035711
MGI: 98738
Ensembl: ENSMUSG00000023885
UniProt: Q03350
Position
17 A2; 17 8.95 cM
AA seq 1172 aa
MLWALALLALGIGPRASAGDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGP
GDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFY
EQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGAEVNTISEH
TETLHLSPHITTDLVVQGVEKAQEVCTHSCEELSNMMNELSGLHVMVNQLSKNLERVSSD
NQFLLELIGGPLKTRNMSACVQEGRIFAENETWVVDSCTTCTCKKFKTVCHQITCSPATC
ANPSFVEGECCPSCSHSADSDEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRTCSLGKCDTRIRQNGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGKNCKGSG
RETKPCQRDPCPIDGRWSPWSPWSACTVTCAGGIRERSRVCNSPEPQYGGKDCVGDVTEH
QMCNKRSCPIDGCLSNPCFPGAKCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDI
CFSTNKAPRCVNTNPGFHCLPCPPRYKGNQPFGVGLEDARTEKQVCEPENPCKDKTHSCH
KNAECIYLGHFSDPMYKCECQIGYAGDGLICGEDSDLDGWPNNNLVCATNATYHCIKDNC
PKLPNSGQEDFDKDGIGDACDEDDDNDGVSDEKDNCQLLFNPRQLDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQIDQDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNSNQADHDNDGKGDACDSDD
DNDGVPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAITETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDKPSRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGYMRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgctctgggcactggccctgctggctctgggcatagggccaagagcttctgctggtgac
cacgtcaaggacacttcatttgaccttttcagcatcagcaacattaaccggaagaccatc
ggtgccaagcagttccgagggcctgaccccggggtgcccgcctaccgttttgtacggttt
gactacatccccccagtgaacacagatgatctcaacaggattgtcaagcttgcaaggaga
aaggagggcttcttcctcacagcccaactgaagcaggaccgcaagtctcggggaacgctc
ctggtgttggaaggccccggcacctcccagaggcagtttgagattgtgtccaatggccca
ggggacactttggacctcaactactgggtagaaggcaatcagcataccaacttcctggag
gatgtgggcctggctgactcccagtggaagaatgtgactgtgcaggtggccagtgacacc
tatagcctgtatgtgggctgcgatcttatcgacagtgtcaccctggaagaaccattctat
gagcagctagaagtagacaggagcaggatgtacgtggccaaaggtgcatctcgagagagt
cacttcaggggcttgctgcagaatgtccatctcgtgtttgcagattctgtggaagatatc
ttaagcaagaaaggctgtcaacacagccagggagctgaagtcaacaccatcagtgaacat
acagagactctccatctgagccctcacatcaccacagatctcgtggtccagggtgtggag
aaggcacaggaggtgtgtacgcactcctgcgaggagttgagcaacatgatgaatgagctc
tctggactgcacgtcatggtgaaccagctgagcaagaacctggagagagtgtctagtgat
aaccagttccttttggagctcattgggggccctctgaagacaagaaacatgtcagcctgt
gtgcaggagggccgaatctttgcagaaaatgaaacctgggttgtggatagttgtaccaca
tgcacctgcaagaaatttaaaacagtctgccatcagatcacctgctcacctgcaacttgt
gccaacccatcttttgtggaaggcgagtgctgtccatcctgttcacactctgcagacagt
gatgagggctggtctccgtgggcagagtggaccgagtgttctgtcacctgtggctctggg
acccagcagagaggccggtcttgtgatgtcaccagcaacacctgcctgggcccctccatt
cagacaaggacatgcagcctgggcaaatgtgatacgagaatccgtcagaatggaggctgg
agtcactggtcaccctggtcttcatgctccgtgacttgtggagttggcaatgtcacccgc
atacgtctctgcaactcaccagtgccccagatgggtggcaagaactgcaagggcagcggc
cgggaaaccaaaccctgtcagcgtgatccgtgcccaattgatggccgctggagcccctgg
tccccttggtcagcctgcacagttacctgtgctggagggatccgtgagcgctcacgtgtt
tgcaacagccctgagccccagtatggagggaaggactgtgtcggggatgtgacagaacac
caaatgtgcaacaagagaagctgccctattgatgggtgcttatccaacccgtgttttcct
ggagccaagtgcaacagcttccctgatgggtcctggtcctgtggctcctgcccagtgggc
tttctgggcaatggtacccactgtgaggacctggatgagtgtgctgtggtcacagatatt
tgcttctcaactaacaaagctccccgctgtgtcaacaccaacccgggcttccactgcctg
ccttgtccaccacgctacaaggggaaccaacccttcggtgttggcctggaggatgctagg
acagaaaaacaagtgtgtgagccagagaatccatgtaaggacaagactcacagctgccac
aagaatgcagagtgcatctacctgggccactttagtgaccccatgtacaagtgtgagtgc
cagattggctacgcaggtgatgggctcatctgcggggaggactcagacctggatggctgg
cccaacaacaacctggtgtgtgctactaatgccacctaccactgcatcaaggacaactgc
cccaaactgccaaattccgggcaggaggattttgataaggatggaatcggagatgcttgt
gacgaggacgatgacaatgacggtgtgagcgatgagaaggacaattgccagcttctcttc
aatccccgtcaattagactatgacaaggatgaggttggagaccgctgtgacaactgcccc
tatgtgcacaacccagcacagatcgacacagacaacaatggcgagggggatgcctgctct
gtggacattgacggagacgatgttttcaatgagcgagacaattgtccatatgtctacaac
actgaccagagagatacggatggtgatggcgtgggtgaccactgtgacaattgtcctctg
atgcacaacccagatcagatcgatcaggacaatgatctcgttggagaccagtgtgacaac
aatgaggacatagatgatgacggccaccagaacaaccaagacaactgcccatacatctcc
aactccaaccaggctgaccatgacaacgacggcaagggcgatgcctgcgactctgatgat
gacaatgatggtgttccagatgacagggacaactgtcggcttgtgttcaacccagaccag
gaagactcggacggtgacggccgaggtgacatttgtaaagatgactttgacaatgataat
gtcccagatattgatgatgtgtgccctgagaacaatgccatcactgagacagacttcaga
aacttccagatggtccctctggatcccaaggggaccacacaaattgatcccaactgggta
attcgtcaccaaggcaaagagctggtgcagacagcaaactcagaccctggcatcgctgta
ggtttcgacgagtttgggtctgtggacttcagtggcactttctatgtcaacactgaccgg
gatgatgactacgctggctttgtctttggctatcagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacccagacctactgggaagacaagcccagtcgggcttacggctac
tctggtgtgtcactcaaagtggtaaactccacgactggtactggcgagcacctgaggaat
gccctgtggcacacgggaaacacagaaggccaggtccggactctatggcatgaccccaaa
aacattggctggaaagactacactgcctacaggtggcacctgattcacaggcctaagaca
ggctacatgagagtcttagtgcatgaaggaaagcaagtcatggctgactcaggaccaatt
tatgaccaaacctacgctggtggacggctgggcctgtttgtcttctcccaagagatggtc
tatttctcggacctcaagtatgagtgcagagatgcctag

KEGG   Mus musculus (mouse): 21827
Entry
21827             CDS       T01002                                 

Gene name
Thbs3, TS, TSP3, Thbs-, Thbs-3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21827 (Thbs3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21827 (Thbs3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21827 (Thbs3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21827 (Thbs3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21827 (Thbs3)
  09174 Infectious disease: parasitic
   05144 Malaria
    21827 (Thbs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21827 (Thbs3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21827 (Thbs3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21827 (Thbs3)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21827 (Thbs3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21827 (Thbs3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21827 (Thbs3)
  Exosomal proteins of colorectal cancer cells
   21827 (Thbs3)
  Exosomal proteins of bladder cancer cells
   21827 (Thbs3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21827 (Thbs3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   21827 (Thbs3)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF
Other DBs
NCBI-GeneID: 21827
NCBI-ProteinID: NP_038719
MGI: 98739
Ensembl: ENSMUSG00000028047
Vega: OTTMUSG00000030357
UniProt: Q05895
Position
3 F1; 3 39.01 cM
AA seq 956 aa
MEKPELWGVLALLLLCSYTCGSQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSPGLQLYVDCKLGDQHAGLPALAPIPPAEVSGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDDSIHNAVTSALQSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPSPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCDDINECAHADPCFPGSSCINTMPGFHCEACPPGYKGTRVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCVPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYIPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSISG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWRLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggagaagccggaactttggggtgtcctggctctcctcctcctctgctcttacacgtgt
ggcagtcaggaccttcaggtaattgacctgctgacagtgggcgaatccaggcagatggta
gctgtggcagagaagattcggacagctttactcactgctggggatatctacctcttgtcc
actttccgcctccctccaaagcaaggtggtgtcctctttggcctctactctcgccaagac
aacacacgatggctggaggcctctgttgtgggcaagatcaacaaagtgctggtgcggtac
cagcgggaagatggcaaagtccatgcagtgaacctacagcaagcaggcctggctgatggg
cgcacacacacggctctcctgcgactccgaggaccttctcgacccagccctggcctgcag
ctgtatgtggactgtaaactgggtgaccaacatgctggccttccagcactggccccgatc
cctccagcagaggtcagtggactggagattagaactggacaaaaggcttatctgaggatg
cagggctttgtggaatcgatgaaaattattctgggtggatccatggctcgggtaggagcc
ctgagtgaatgtccattccaaggagacgactccattcacaatgcagtgaccagcgcactg
caatccattctaggggagcagaccaaggcattggtcacccagctcaccctcttcaaccag
atcctagtggagcttcgggacgacatccgagaccaggtgaaggaaatgtcactcatccgg
aacaccatcatggagtgtcaggtgtgcggtttccacgagcagcgttcacactgcagcccc
agcccctgcttccgaggcgtggactgtatggaagtgtatgagtacccgggctatcgctgt
gggccctgcccacctggcctgcagggcaatggcacccactgtgatgacatcaacgagtgt
gctcacgctgacccctgtttcccggggtccagctgcatcaacaccatgcctggcttccac
tgcgaggcctgtcctccagggtacaagggcacccgagtgtctggtgtgggcatcgactat
gctcgagccagcaaacaggtctgcaatgacattgatgaatgtaatgatggtaacaacgga
ggctgtgacccaaattccatctgcaccaacacggtggggtctttcaaatgtggtccctgc
cgcctgggtttcctggggaaccagagccagggctgcgttccagcaaggacctgccacagc
cctgcccacagcccctgccacatccacgcccactgtctctttgaacgcaatggcgctgtg
tcatgccagtgtaacgtgggctgggcagggaatgggaacgtgtgtgggcctgacacagat
atagacggctatccggaccaggctcttccctgcatggataacaacaagcactgcaagcag
gacaattgccttttgacacccaactctgggcaagaagatgctgataacgatggtgtcggg
gaccagtgtgatgacgatgctgacggggatggtatcaagaatgtggaggacaattgtcga
ctgttccccaacaaggaccagcagaattcagacacagactcgtttggtgatgcctgcgac
aactgtcccaatgttcccaacaatgaccagaaggacacggatggcaatggagaaggagat
gcctgtgacaacgatgtggacggggatggcatccccaacgggttggacaattgccctaaa
gtacccaacccactgcagacagaccgggatgaagacggagtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagcgacctggtgggggatgtc
tgtgacaccaacgaagacagcgacggagacgggcaccaggacaccaaggacaactgtcct
cagctgccaaatagctctcagctggactcagacaatgacgggcttggagatgagtgtgac
ggggacgatgacaatgacggtgtcccagattacattcctcccgggcctgataactgtcgc
ctggtacccaatcctaatcagaaggactcagatggcaacggtgtgggtgatgtctgtgaa
gatgactttgacaatgacgcagtggttgaccctctggatgtgtgcccggagagtgcagaa
gttaccctcacagacttccgggcctatcagactgtgatcctggatcccgagggtgacgcc
cagatcgatccaaactgggtagtgctcaaccagggcatggaaattgttcagactatgaac
agtgacccgggtcttgcagttgggtacacggcctttaatggcgtggactttgaaggcacc
ttccacgtgaacacagtcactgatgatgactatgcgggcttcctcttcagttaccaggac
agtggccgcttctatgtggtcatgtggaaacagacggagcagacctactggcaggccacg
cctttccgagcagtggcccaaccagggcttcagctcaaggcagtgacatccatatctggc
ccaggtgagcacctccggaatgctctgtggcatactggccacacccctgatcaggtacga
ctgctgtggactgacccacggaatgtgggttggcgagacaagacatcctatagatggcgg
ctgctccaccggccccaagttggctacattcgggtgaagctctatgagggtccccagcta
gtggcggattctggggtgattattgacacgtccatgcgaggggggcgtctcggcgtattc
tgcttctcccaagaaaacatcatttggtccaatctccagtaccgatgcaatgacacagtg
cctgaggactttgagccattccggaggcagctgctccagggaagagtgtga

KEGG   Mus musculus (mouse): 21828
Entry
21828             CDS       T01002                                 

Gene name
Thbs4, TS, TSP, TSP4
Definition
(RefSeq) thrombospondin 4
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21828 (Thbs4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21828 (Thbs4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21828 (Thbs4)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21828 (Thbs4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21828 (Thbs4)
  09174 Infectious disease: parasitic
   05144 Malaria
    21828 (Thbs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21828 (Thbs4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21828 (Thbs4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21828 (Thbs4)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21828 (Thbs4)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21828 (Thbs4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21828 (Thbs4)
  Exosomal proteins of colorectal cancer cells
   21828 (Thbs4)
  Exosomal proteins of bladder cancer cells
   21828 (Thbs4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21828 (Thbs4)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   21828 (Thbs4)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 EGF cEGF EGF_MSP1_1
Other DBs
NCBI-GeneID: 21828
NCBI-ProteinID: NP_035712
MGI: 1101779
Ensembl: ENSMUSG00000021702
Vega: OTTMUSG00000036725
UniProt: Q9Z1T2 B2RTL6
Position
13 C3; 13 47.75 cM
AA seq 963 aa
MPAPRAAAAAFLLLHLVLQPWQRTSAQATPQVFDLLPSSSQRLNPSALQPVLTDPTLHEV
YLISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQ
LADGRRHRVLLRLSNLQRGDGSVELYLDCAQADSVRNLPRAFSGLTQNPESIELRTFQRK
PQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVK
DLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAPPAPPTRPTRHCDSSPCFRG
VRCTDTRDGFQCGPCPDGYTGNGITCSDVDECKYHPCYPGVRCVNLAPGFRCDACPVGFT
GPMVQGVGINFAKTNKQVCTDVDECQNGACVLNSICINTLGSYRCGPCKPGYTGDQTRGC
KTERSCRNPEQNPCSVHAQCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCS
ARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNIDQRNSDKDI
FGDACDNCRMVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPRVPNRDQQDRDGDDV
GDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSSQLDTDKDG
IGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNNDGVGDICEADFDQDQVIDHIDV
CPENAEITLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNG
VDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKA
VKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRF
YEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQSFDR
LDN
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgccggccccacgcgcggccgcggccgccttcctcctgctgcacctggtcctgcagccg
tggcagcggacgagcgcccaggccacaccccaggtctttgatcttctaccgtcctccagc
cagaggctgaaccccagcgccctgcagccagtcctgacagatcccaccctgcacgaagtc
tatctcatctccaccttcaagctgcagagtaaaagctcagccaccatctttggcctctac
tcctcaagtgacaacagcaaatactttgaattcactgtgatgggacggctgaacaaagcc
atcctccgctacctgaagaatgatggaaagatccatctggtggtgttcaacaacttgcag
ctggctgatgggaggcgccacagggttctcctgagactgagcaatttgcagagaggagat
ggctctgtagaactctacctggactgcgctcaggcggactcggtgcgcaacctccccaga
gccttttctggcctcacccagaacccagagtccattgaattgcggacattccagaggaag
ccccaggacttcttggaagagctgaagctggtggtgcggggctcgctgttccaggtggcc
agcctccaagactgcttcctgcagcagagtgagcctctggctgccacaagcacaggagac
tttaatcgacagttcttgggtcaaatgacacaactgaaccagctccttggagaggtgaaa
gatcttctgaggcagcaggtcaaggaaacatcgtttttgcgaaacaccattgctgaatgc
caagcttgtggtcctctcagctttcagtccccaactccaaacacactggtgcccatagct
cctccagcacccccaactcgcccaacacgccactgtgactccagcccttgtttccgaggt
gtccgatgtacggacaccagggatggcttccagtgtggaccctgcccagatggttacacg
ggaaacgggatcacctgctctgacgtggatgagtgcaaataccatccctgctatccaggt
gtgcgctgtgtgaatttggctccgggtttcagatgtgacgcctgtccagtaggtttcaca
gggcccatggtgcagggtgtcgggatcaactttgctaaaacaaacaagcaggtgtgcact
gatgttgatgagtgtcagaatggagcgtgtgttctgaattctatctgcattaacactttg
ggatcttatcgctgtgggccttgcaaaccagggtacactggtgatcagacgaggggatgc
aagactgaaaggagctgccggaacccagagcagaacccatgcagtgtgcatgcgcagtgc
attgaggagcggcaaggggatgtgacgtgtgtgtgtggtgttggctgggctggtgacggc
tatgtctgtggaaaggatgtggacattgacagttaccctgatgaagaactgccatgctct
gccaggaactgcaagaaggataactgcaagtatgtgccaaactctggccaggaagatgca
gacagagatggcatcggagacgcgtgtgatgaggatgcagatggagatgggatcttgaat
gaacaggacaactgtgtcctgactcacaatatagaccaaaggaacagtgataaagatatc
tttggggatgcctgtgacaactgccggatggtcctgaataatgaccagaaggatactgac
ggggatgggagaggagacgcctgtgatgacgacatggatggagatggaataaaaaacatt
ttggacaactgtcccagagttcccaaccgtgaccagcaggatcgggatggtgatgatgtc
ggagatgcttgtgacagctgtcctgatgtcagtaaccctaaccagtcggatgtggataac
gatctggttggggactcctgtgacaccaaccaagacagtgacggggatggccaccaggac
agcacagacaactgccccacagtcattaacagctcccagctggacactgacaaagatggg
atcggcgatgaatgtgatgacgatgacgataacgatggcatcccagacctggtgcctcct
ggcccagacaactgcaggctcgtccccaacccagcccaggaagatagcaacaatgacggg
gtaggagatatctgtgaagctgacttcgaccaggaccaggtcatcgatcacattgatgtg
tgccctgagaatgcggagatcaccctgactgacttcagggcctaccagacagtggtcctg
gaccctgaaggggatgctcagatcgaccccaactgggtggtcctgaaccagggcatggaa
attgtgcagaccatgaacagtgaccctggcctagctgttgggtacacggcatttaacgga
gttgactttgaagggaccttccacgtaaacacccagacagatgatgactatgctggcttt
atttttggttaccaagacagctccagcttctatgtagtcatgtggaagcaaacggagcag
acatactggcaggctacaccgttccgtgcagtagcagaacctggtattcagctcaaggct
gtgaagtctaaaactggcccaggggaacatctccgaaactccctgtggcacacaggggac
accagcgaccaggtcaggctgctgtggaaggactccaggaatgtgggctggaaggacaag
gtctcctaccgctggttcctgcagcataggccccaggtgggctacatcagggtgcgcttt
tatgaaggctcggagttggtggctgactctggggtcaccatagacaccaccatgcgtgga
ggccgacttggtgtgttctgcttctctcaagaaaacatcatctggtccaacctcaagtac
cgctgcaacgacaccataccagaggacttccaggagttccagacccagagtttcgaccgc
ttggataattga

KEGG   Mus musculus (mouse): 21923
Entry
21923             CDS       T01002                                 

Gene name
Tnc, AI528729, C130033P17Rik, Hxb, T, TN, TN-, TN-C, Ten, cytota, cytotactin, tenas, tenascin-C
Definition
(RefSeq) tenascin C
  KO
K06252  tenascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21923 (Tnc)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21923 (Tnc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21923 (Tnc)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21923 (Tnc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21923 (Tnc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21923 (Tnc)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21923 (Tnc)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin EGF Pur_ac_phosph_N DUF2369 fn3_2 hEGF Interfer-bind DUF4998
Other DBs
NCBI-GeneID: 21923
NCBI-ProteinID: NP_035737
MGI: 101922
Ensembl: ENSMUSG00000028364
Vega: OTTMUSG00000000302
UniProt: Q80YX1 Q148T5 Q8C9Z1
Position
4 C1; 4 34.06 cM
AA seq 2019 aa
MGAVTWLLPGIFLALFALTPEGGVLKKIIRHKRESGLNMTLPEENQPVVFNHIYNIKLPM
GSQCSVDLESASGEKDLTPTPESSGSFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELELLVSSLREQCTMGTGCCLQPAEGRLDTRPFCSGRGNFSAEGCGCVCEPGW
KGPNCSEPDCPGNCNLRGQCLDGQCICDEGFTGEDCSQLACPNDCNDQGRCVNGVCVCFE
GYAGPDCGLEVCPVPCSEEHGMCVDGRCVCKDGFAGEDCNEPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGELTCPNDCQGRGQCEEGQ
CVCNEGFAGADCSEKRCPADCHHRGRCLNGQCECDDGFTGADCGDLQCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQRRCPNDCHNRGLCVQGKCICEQGFKGFDCSEMSCPNDCHQHGRC
VNGMCICDDDYTGEDCRDRRCPRDCSQRGRCVDGQCICEDGFTGPDCAELSCPSDCHGHG
RCVNGQCICHEGFTGKDCKEQRCPSDCHGQGRCEDGQCICHEGFTGLDCGQRSCPNDCSN
QGQCVSGRCICNEGYTGIDCSEVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLIMYTPTH
ADGLEMQFRVPGDQTSTTIRELEPGVEYFIRVFAILENKRSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKKVTTTRLDAPSHIEVKDVTDTTALITWFKPLAEIDSIELSYGIK
DVPGDRTTIDLTHEDNQYSIGNLRPDTEYEVSLISRRVDMASNPAKETFITGLDAPRNLR
RVSQTDNSITLEWRNVKADIDSYRIKYAPISGGDHAEIDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKGDKESDPATINAATEIDAPKDLRVSETTQDSLTFFWTTPLAKFDRYRLNYS
LPTGQSMEVQLPKDATSHVLTDLEPGQEYTVLLIAEKGRHKSKPARVKASTEEVPSLENL
TVTEAGWDGLRLNWTADDLAYEYFVIQVQEANNVETAHNFTVPGNLRAADIPGLKVATSY
RVSIYGVARGYRTPVLSAETSTGTTPNLGEVTVAEVGWDALTLNWTAPEGAYKNFFIQVL
EADTTQTVQNLTVPGGLRSVDLPGLKAATRYYITLRGVTQDFGTAPLSVEVLTEDLPQLG
GLSVTEVSWDGLTLNWTTDDLAYKHFVVQVQEANNVEAAQNLTVPGSLRAVDIPGLKADT
PYRVSIYGVIQGYRTPMLSTDVSTAREPEIGNLNVSDVTPKSFNLSWTATDGIFDMFTIE
IIDSNRLLQTAEHNISGAERTAHISGLPPSTDFIVYLSGIAPSIRTKTISTTATTEAEPE
VDNLLVSDATPDGFRLSWTADEGIFDSFVIRIRDTKKQSEPQEISLPSPERTRDITGLRE
ATEYEIELYGISRGRRSQPVSAIATTAMGSPKEIMFSDITENAATVSWRAPTAQVESFRI
TYVPMTGGAPSMVTVDGTDTETRLVKLTPGVEYRVSVIAMKGFEESDPVSGTLITALDGP
SGLLIANITDSEALAMWQPAIATVDSYVISYTGERVPEVTRTVSGNTVEYELHDLEPATE
YILSIFAEKGQQKSSTIATKFTTDLDSPREFTATEVQSETALLTWRPPRASVTGYLLVYE
SVDGTVKEVIVGPDTTSYSLADLSPSTHYSARIQALSGSLRSKLIQTIFTTIGLLYPFPR
DCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKA
YAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLK
VEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNN
HSQGVNWFHWKGHEYSIQFAEMKLRPSNFRNLEGRRKRA
NT seq 6060 nt   +upstreamnt  +downstreamnt
atgggggccgtgacctggctactgccaggcatctttctagctttgtttgccctcactccc
gaaggtggggtcctcaagaaaatcatcaggcacaagcgagagagtgggctaaacatgacc
ctgccagaagagaatcagccagtggtgttcaaccatatctacaacatcaagttgcccatg
ggttcccaatgctcagtggatctggagtcagcgagtggggagaaagacctgacccccacg
ccagagtccagtgggagcttccaggaacatacagtggatggggaaaaccaaattgtattc
acacaccgcatcaacatcccccgccgggcctgtggctgtgctgcagctccagatgtgaag
gagctcctgagcaggctggaggagctggagttgctggtatcgtctctaagggagcagtgc
accatgggtacaggctgttgcctccaacctgcagaaggtcgtctggacaccaggcccttc
tgcagcggacggggcaacttcagtgcagaaggctgcggctgtgtctgtgaaccaggctgg
aaaggccccaactgctctgagcctgactgccctgggaactgtaatctcagaggccagtgc
cttgacggccagtgtatctgtgacgagggtttcactggggaagactgcagccagctggcc
tgtccgaacgactgcaatgaccagggcaggtgtgtgaacggggtctgtgtgtgcttcgaa
ggctatgccggccctgactgtggcctggaagtctgcccagtgccctgcagcgaggaacac
gggatgtgtgtggatggcaggtgtgtgtgcaaagatggctttgcgggtgaggactgcaac
gagcccctttgcctcaacaactgctacaatcgtgggcggtgtgtggagaacgagtgtgtc
tgcgacgagggcttcactggcgaggactgcagtgagctcatttgccccaacgactgcttc
gaccgcggtcgctgcatcaatggcacctgctactgtgaagaaggtttcacgggcgaagac
tgcggtgagctcacctgccccaacgactgtcagggccgtggccagtgtgaggagggacag
tgtgtttgcaacgagggctttgcaggagcagactgcagtgaaaagcggtgtcccgccgat
tgtcaccaccgtggccgctgcctcaacgggcagtgtgagtgtgacgatgggttcacaggg
gctgactgtggggatctccagtgtcccaatggctgcagtgggcatggccgttgtgtcaac
gggcagtgcgtgtgtgacgagggctataccggagaagactgtagccagcggcgatgcccc
aatgactgtcacaaccggggtctctgcgtacagggcaagtgcatatgtgaacaaggcttc
aagggctttgactgtagtgagatgagctgtcccaatgactgccaccaacatggccgctgt
gtgaatggcatgtgtatctgtgatgacgactacactggggaagactgcagagaccggcgc
tgtccccgggactgtagccagcgggggcgctgtgtagacggacagtgcatctgtgaggat
ggcttcactggccctgactgtgctgagctttcctgccccagtgactgccacggccatggc
cgctgtgtgaatggccaatgcatctgccacgagggcttcactggcaaagactgcaaagag
caaaggtgccccagtgattgccatggccaaggccgctgtgaggacggccagtgtatctgc
catgagggctttacgggcctggactgtgggcagcgctcctgtcccaatgactgcagcaac
caaggacaatgtgtgtcaggccgctgcatctgcaatgaaggttacacagggatagactgc
tctgaggtgtcccctcccaaagaccttattgtgacagaagtaacagaggagactgtaaat
ctggcatgggacaatgagatgcgggtcactgagtacctcattatgtacacacccacccat
gctgatggcctagagatgcagttccgtgtgcctggggaccagacatccaccaccattcgg
gagctggaaccaggggtggagtacttcattcgtgtgttcgccatcttggaaaacaagagg
agcatccctgtcagtgccagggttgccacctatttgcctgcacctgaaggtctaaaattc
aagtctatcaaggagacatctgtggaagtagagtgggatcctctagacattgctttcgaa
acatgggagatcattttccgaaatatgaacaaagaagatgagggagagatcacaaaaagt
ctgaggagaccagagacctcctaccgccaaactggccttgctcctggccaagagtatgaa
atatctctgcacattgtgaaaaacaacacccgaggccccggcttgaagaaagtaaccaca
acccgcctggatgcccccagccatattgaggtgaaagatgtcacagacaccacagcactg
atcacctggttcaagcccttggctgaaattgatagcattgagctctcctatggcatcaag
gatgtacctggagaccgtaccaccatcgacctcacacacgaagacaaccagtactccatc
gggaacctgagacctgacacggagtatgaggtgtccctcatctcccgcagagtggacatg
gcaagcaaccctgccaaagagaccttcatcacaggcctggatgctcccaggaatctccgc
cgtgtctcacagacagacaacagcatcaccttggagtggaggaacgtcaaggcagacatc
gacagttacagaattaagtatgcccctatctctggaggtgaccatgctgagatagatgtt
ccaaagagccagcaagccacaaccaaaaccacactcacaggtctaaggcccggaactgaa
tatgggattggtgtttctgctgtcaagggagacaaggagagtgatccagcaaccatcaat
gcggccacagaaattgatgcacccaaggacttacgggtgtctgaaaccacacaagacagt
ctgacgtttttctggacgacacccctggccaagtttgatcgttaccgcctcaactacagc
ctccccacaggccagtcgatggaagtccagctgccaaaggatgccacctcccatgtcctg
acagacctggagccagggcaagaatacactgttctcctcattgctgagaagggcagacac
aagagcaagcctgcacgtgtgaaggcatccacggaagaagtgccttccctggaaaatctc
actgtgactgaggccggctgggatggcctcagactcaactggactgcagatgacctggcc
tatgagtactttgtcattcaggtacaggaagccaacaatgtggagactgctcacaacttc
acagtacctggtaacctccgggctgcagacatcccaggcctcaaggttgccacttcttat
agagtctccatctatggggtagcccggggctatagaacaccagtgctctctgccgagacc
tccacagggacaactcccaatctgggagaggtcactgtggccgaggtgggctgggatgcc
ctcacgctcaactggactgctccagaaggagcctataagaactttttcattcaggtgcta
gaggctgacacgacccagactgtccagaacctcacagtcccaggaggactgaggtcagtg
gacctgcctgggctcaaagcagccacccgctactacatcacccttcgaggggtcacccag
gacttcggcacggcccctctctctgttgaggtcttgacagaggatctccctcagctggga
ggcttgtctgtgactgaggtcagctgggacggcctcacactcaactggaccacagatgac
ctggcctataagcactttgtcgttcaggtgcaggaggccaacaatgtggaggccgctcag
aacctcacggtacccggcagcctcagagctgtggacatcccaggcctcaaggccgacacc
ccttatagagtctccatctacggggtcatccagggctatagaacaccgatgctctctact
gacgtctccacagccagagaacctgaaattggaaacttaaatgtttctgatgtaactcct
aagagcttcaatctctcctggacagctaccgacgggatcttcgacatgtttactattgaa
attattgattctaataggttgctgcaaacagcagaacataatatatctggtgctgaacgg
actgcccacatctcagggcttccacctagtactgatttcattgtctacctctctggaatt
gctcccagcatccgtaccaaaaccatcagtaccacggctaccacagaagctgaaccggaa
gttgacaaccttctagtttcagatgccactccagacggtttccgtctgtcctggactgct
gatgaagggatattcgacagttttgttatcaggatcagagataccaaaaagcaatctgag
ccacaagaaatatccctcccttcccccgaacgtaccagggacataacaggtctcagagag
gccactgagtacgaaattgaactctatggaataagccgcggaaggcgatcccagccagtc
agtgccatagcaacaacagccatgggttctccgaaggaaatcatgttctcagacatcact
gaaaatgcagccacagtcagctggagggcacctactgctcaggtggagagtttccggatc
acttatgtacctatgacaggaggtgccccgtccatggtgactgtggatggaacagatact
gagaccaggctggtgaagcttaccccgggtgtagagtaccgcgtcagtgtgattgccatg
aagggattcgaagaaagcgatccagtctcggggactctaatcacagctctggatggtcca
tctggtcttctgatagccaacatcacagactcagaagccttggccatgtggcagccagcc
attgccactgtggacagttatgtcatctcctacacaggggagagagtgccagaagttaca
cgcacagtgtctggaaatacagtggagtacgagctgcatgacctggagcctgccacagag
tacatcctgagtatctttgcagagaaaggacagcagaagagctctaccatcgccaccaag
tttaccacagacctcgattccccaagagaatttacagctacagaggttcagtcagaaact
gccctccttacctggagacctccccgagcatcggtcactggatacctcctggtctatgaa
tctgtggatggtacagtcaaggaagtcattgtggggcctgacaccacctcctacagcctg
gcagacctgagcccatccacccactactcagcaaggatccaggcattgagtgggtccctg
aggagcaagctgatccaaaccatcttcacaacaattggactcctgtacccattccccagg
gactgctctcaagcaatgttgaatggtgatactacctctggcctctacaccatctatata
aatggtgacaagactcaagcactggaagtctactgtgatatgacctctgatggaggtgga
tggattgttttcctgagacgcaaaaatggacgtgaggacttctatcgcaactggaaggcc
tatgctgctgggtttggagaccgcagagaagaattttggcttggactggataacctgagc
aaaatcacagcccaagggcagtatgagctccgggtggacctacaagaccatggggagtct
gcctatgctgtgtacgacagattcagtgttggagatgccaagagtcgctacaagctgaag
gtagaaggatacagtggaacagcaggtgactccatgaactatcacaatggtagatccttc
tccacctatgacaaggacacagactcagccatcaccaactgtgccctgtcctacaaagga
gctttctggtataagaactgtcatcgtgtcaacctgatgggcagatatggggacaataac
cacagtcagggcgttaactggttccattggaagggccatgagtactcaatccagtttgct
gagatgaaactgagacccagcaacttccgaaatctggaaggcaggcgtaagcgggcataa

KEGG   Mus musculus (mouse): 21960
Entry
21960             CDS       T01002                                 

Gene name
Tnr, J1-ten, J1-tenascin, TN, TN-R, ja, janusin, rest, restrictin
Definition
(RefSeq) tenascin R
  KO
K06252  tenascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21960 (Tnr)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21960 (Tnr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21960 (Tnr)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21960 (Tnr)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21960 (Tnr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21960 (Tnr)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21960 (Tnr)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_Tenascin EGF_2 Tissue_fac EGF TolA_bind_tri
Other DBs
NCBI-GeneID: 21960
NCBI-ProteinID: NP_071707
MGI: 99516
Ensembl: ENSMUSG00000015829
Vega: OTTMUSG00000050612
UniProt: Q8BYI9
Position
1; 1 H1
AA seq 1358 aa
MGIDGETVVLKNMLIGVNLILLGSMLKPSECRLEVTTERAQRQTVEEEGGASSYNTSSKE
QPMVFNHVYNINVPLESLCSSGLEASAEQDMSAEDDTLAEYIGQTSDHESQVTFTHKINL
PKKACPCASSSQVLQELLSRIEMLEREVSLLRDQCNTNCCQESAATGQLDYVPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGQCANGTCLCQEGYAGEDCSQRRCLNA
CSGRGHCQEGLCICEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTIMELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQLPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWTPPRAKVDFILLKYGL
VGGEGGKTTFRLQPPLSQYSVQALRPGSRYEVSISAVRGTNESEASSTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEAQEYKVVYSTLAGEQYHEVLVPKGIGPTTKTTLTDLVPGT
EYGVGISAVMNSKQSIPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGISSEVTVPRDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDKEEDMLEVLLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKNITISNVTKDSLTVSWSSPVAPFDYYRVSYRP
TQVGRLDSSVVPNTVTEFAITRLYPATEYEISLNSVRGREESERICTLVHTAMDSPMDLI
ATNITPTEALLQWKAPMGEVENYVIVLTHFAIAGETILVDGVSEEFQLVDLLPSTHYTVT
MYATSGPLMSGTIATNFSTLLDPPDNLTASEVTRQSALISWQPPRAAIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLSENTDYTVLLQAAQEATRSSLTSTVFTTGGRVFSHPQDCAQ
HLMNGDTLSGVYTIFLNGELSHKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNLEDEFWLGLDNIHRITAQGRYELRVDMRDGQEAVFAYYDKFAVEDSRSLYKIRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYIHRLTAGRKRRALKF
NT seq 4077 nt   +upstreamnt  +downstreamnt
atggggatcgatggggaaacagtagtcttgaagaacatgctcattggtgtaaacctgatc
ctgttgggatccatgctcaagccttctgagtgtcggctggaggtgactacagaaagggct
cagagacaaactgtggaggaggaaggaggggcttccagctacaatacttccagcaaggaa
cagcctatggtcttcaaccatgtgtataacatcaacgtgccacttgaaagcctctgctcc
tcggggctggaggcctcagctgagcaggacatgagtgctgaagatgatactctggccgaa
tacataggccaaacctcagaccatgaaagccaggttaccttcacccacaagatcaacctc
cccaaaaaagcctgcccatgtgcaagctcttcccaggtactgcaggaactgctgagccgg
atcgagatgctggagagggaggtgtccttgctgcgagaccagtgcaataccaactgctgt
caggaaagcgctgccacaggacaactggactatgtccctcactgcagcggccatggcaac
tttagcttcgagtcctgtggctgcatctgcaatgaaggctggtttggcaagaactgctca
gagccctactgcccactgggctgctccagtcggggtgtgtgtgtcgatggccagtgcatt
tgtgacagtgaatacagcggagatgactgttcagagctccggtgcccaacagactgcagt
tcccgagggctctgtgtggatggggaatgtgtctgtgaagagccctacacaggcgaggac
tgcagggagctgcgctgccctggggactgttcagggaaggggcaatgtgccaatggtacc
tgcctgtgccaagagggctatgctggtgaggactgcagccagcgacggtgtctgaatgcc
tgcagtgggcgaggtcactgccaggaggggctctgcatctgtgaggaaggctaccagggc
cctgactgctcagcagttgcccctccagaggacttgcgagtggctggtatcagcgacagg
tccattgagctggaatgggacgggccgatggcagtgacggaatatgtgatctcttaccag
ccgacggccctggggggccttcagctccagcagcgggtgcctggagattggagtggtgtc
accatcatggagctggagccaggtctcacctacaacatcagcgtctacgctgtcattagc
aacatcctcagccttcccatcactgccaaggtggccactcatctctccactcctcaaggg
ctacagttcaagacgatcacagagaccaccgtggaggtgcagtgggagcccttctctttc
tccttcgacgggtgggagatcagcttcattccaaagaacaatgaaggaggggtgattgct
cagctccccagcgatgtgacgtcctttaaccagacaggactgaaacctggggaggagtac
attgtgaatgttgtggctctaaaggaacaagcccggagccctcctacctctgccagcgtc
tccactgtcattgacgggcccacacagatcctggttcgagatgtctctgatactgtggct
tttgtggaatggaccccacctcgagccaaagttgatttcattcttttaaaatatggcttg
gtgggtggcgaaggcgggaagacgaccttccggctgcagcctcccttaagccagtactcc
gtgcaagcccttagacctggctcgcgctacgaggtgtccatcagcgcagtccgggggacc
aatgagagtgaagcctcaagcacccaatttacaacagagattgatgctcccaagaatttg
cgagtgggttcccgcacagcaactagccttgacctggaatgggataacagcgaggccgaa
gctcaggagtacaaggttgtgtacagcaccttagctggtgaacagtaccacgaagtgctg
gtacccaagggcattggcccaactaccaagactaccctcacagatctggttccaggcaca
gagtatggagttggaatatctgcagtaatgaactcaaaacaaagcattcctgccactatg
aatgccaggactgaacttgacagtccccgagacctcatggtaacagcctcctcagagacc
tctatctctctcatctggaccaaggccagtggtcccattgatcactacagaattactttt
accccatcttctgggatctcctccgaagtcactgtgcccagggataggacttcatacaca
ctaacagatctagagcctggagcagaatacattatctccatcactgctgagaggggtcgg
cagcagagcctggagtctactgtggatgccttcacaggcttccgccctatctcccatttg
cacttttctcatgtgacctcctccagtgtcaatatcacctggagtgacccatctccccca
gcagacagactcattctgaactacagccccagggacaaagaggaagacatgttggaggtc
ctcttggatgccaccaagaggcacgctgtcttgatgggtctacagccagccactgaatat
atagtgaaccttgtagctgtccatgggacggtaacctctgaacccatagtgggttctatc
actacaggaattgatcctcccaaaaacatcacaattagcaacgtgactaaggactccctg
acggtgtcctggagctctcctgttgcgccttttgattactaccgagtatcgtaccgaccc
acccaagtgggacggctagacagctccgtagtgcccaacaccgtgacagagttcgccatc
accaggctgtatccagctactgaatatgaaataagcctcaacagtgtacggggcagggag
gagagtgaacgcatctgcaccctggtgcacacagccatggatagccccatggatttgatc
gctaccaacatcacacctacagaagccttgctccagtggaaagcacccatgggtgaagtg
gaaaattatgtcatcgtcctcacacactttgcaattgctggagagaccatcctggttgac
ggggtcagcgaagaattccagcttgtagacttgcttcctagcacccactacactgtcact
atgtatgccaccagtgggcctctcatgagtggcaccattgccaccaacttctccaccctc
ctggaccctcctgacaacctgacagccagtgaagtcaccaggcaaagcgcactgatctcc
tggcagccgcccagagctgcgattgaaaactatgtcttgacatacaagtccaccgatgga
agccgcaaagagctgatagtggatgctgaggacacctggatccgactagagggcctgtca
gagaacacagactacacagtgctcctgcaggcagcccaggaggccacaaggagcagtctc
acctctactgtctttaccacagggggccgggtgttctctcatcctcaagactgtgcccag
catttgatgaatggagacactctgagtggcgtttacaccatcttcctcaatggggagcta
agccacaagctgcaagtgtactgtgacatgaccacagatgggggcggctggattgtattc
cagaggcggcaaaatggacaaactgattttttccggaaatgggcagattatcgtgttggc
tttgggaatctggaggatgagttttggctagggctagacaacatccacaggataacagcc
cagggccgctatgagctgcgtgtggatatgcgggatggacaggaagcagtctttgcctac
tatgacaagttcgctgtggaggacagcagaagcctgtacaagatccgcataggaagttac
aatggcactgcaggagactccctcagctatcaccagggacgtcctttctccactgaggac
agagacaatgatgttgcagtcaccaactgtgccatgtcctacaagggtgcttggtggtat
aagaactgccaccggaccaacctcaacgggaagtacggggagtccaggcacagtcagggg
atcaactggtaccattggaaaggccatgaattctccatcccctttgtagaaatgaagatg
aggccctacatccatcgtctcacagccgggaggaaacggcgagccttgaaattctga

KEGG   Mus musculus (mouse): 22370
Entry
22370             CDS       T01002                                 

Gene name
Vtn, AI256434, Vn
Definition
(RefSeq) vitronectin
  KO
K06251  vitronectin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04610  Complement and coagulation cascades
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    22370 (Vtn)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    22370 (Vtn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22370 (Vtn)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    22370 (Vtn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    22370 (Vtn)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    22370 (Vtn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22370 (Vtn)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22370 (Vtn)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22370 (Vtn)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   22370 (Vtn)
SSDB
Motif
Pfam: Hemopexin Somatomedin_B
Other DBs
NCBI-GeneID: 22370
NCBI-ProteinID: NP_035837
MGI: 98940
Ensembl: ENSMUSG00000017344
Vega: OTTMUSG00000000143
UniProt: P29788
Position
11 B5; 11 46.74 cM
AA seq 478 aa
MAPLRPFFILALVAWVSLADQESCKGRCTQGFMASKKCQCDELCTYYQSCCADYMEQCKP
QVTRGDVFTMPEDDYWSYDYVEEPKNNTNTGVQPENTSPPGDLNPRTDGTLKPTAFLDPE
EQPSTPAPKVEQQEEILRPDTTDQGTPEFPEEELCSGKPFDAFTDLKNGSLFAFRGQYCY
ELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPGYPR
NISEGFSGIPDNVDAAFALPAHRYSGRERVYFFKGKQYWEYEFQQQPSQEECEGSSLSAV
FEHFALLQRDSWENIFELLFWGRSSDGAREPQFISRNWHGVPGKVDAAMAGRIYVTGSLS
HSAQAKKQKSKRRSRKRYRSRRGRGHRRSQSSNSRRSSRSIWFSLFSSEESGLGTYNNYD
YDMDWLVPATCEPIQSVYFFSGDKYYRVNLRTRRVDSVNPPYPRSIAQYWLGCPTSEK
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcacccctgaggccctttttcatactagccctggtggcatgggtttctctggctgac
caagagtcatgcaagggccgctgcactcagggtttcatggccagcaagaagtgtcagtgt
gacgagctttgcacttactatcagagctgctgtgccgactacatggagcagtgcaagccc
caagtaacgcggggggacgtgttcactatgccagaggatgattattggagctatgactac
gtggaggagcccaagaacaataccaacaccggtgtgcaacccgagaacacctctccaccc
ggtgacctaaatcctcggacggacggcactctaaagccgacagccttcctagatcctgag
gaacagccaagcaccccagcgcctaaagtggagcaacaggaggagatcctaaggcccgac
accactgatcaagggacccctgagtttccagaggaagaactgtgcagtggaaagcccttt
gacgccttcacggatctcaagaatgggtccctctttgccttccgagggcagtactgctat
gagctagatgagacggcagtgaggcctgggtaccccaaacttatccaagatgtctggggc
attgagggccccatcgatgctgccttcactcgcatcaactgtcaggggaagacctacttg
ttcaagggtagtcagtactggcgctttgaggatggggtcctggaccctggttatccccga
aacatctccgaaggcttcagtggcataccagacaatgttgatgcagcgttcgcccttcct
gcccaccgttacagtggccgggaaagggtctacttcttcaaggggaagcagtactgggag
tacgaatttcagcagcaacccagccaggaggagtgcgaaggcagctctctgtcagccgtg
tttgagcactttgccttgcttcagcgggacagctgggagaacattttcgaactcctcttc
tggggcagatcctctgatggagccagagaaccccaattcatcagccggaactggcatggt
gtgccagggaaagtggacgctgctatggccggccgcatctacgtcactggctccttatcc
cactctgcccaagccaaaaaacagaagtctaagcgtagaagccgaaagcgctatcgttca
cgccgagggcgtggccacagacgcagccagagctcgaactcccgtcgttcatcacgttca
atctggttctctttgttctccagcgaggagagtgggctaggaacctacaacaactatgat
tatgatatggactggcttgtacctgccacctgcgagcccattcagagcgtctatttcttc
tctggagacaaatactaccgagtcaaccttagaacccggcgagtggactctgtgaatcct
ccctacccacgctccattgctcagtattggctgggctgcccgacctctgagaagtag

KEGG   Mus musculus (mouse): 22371
Entry
22371             CDS       T01002                                 

Gene name
Vwf, 6820430P06Rik, AI551257, B130011O06Rik, C630030D09, F8VWF, VWD
Definition
(RefSeq) Von Willebrand factor
  KO
K03900  von Willebrand factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu05165  Human papillomavirus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    22371 (Vwf)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    22371 (Vwf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22371 (Vwf)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    22371 (Vwf)
   04611 Platelet activation
    22371 (Vwf)
   04613 Neutrophil extracellular trap formation
    22371 (Vwf)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    22371 (Vwf)
   05165 Human papillomavirus infection
    22371 (Vwf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    22371 (Vwf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    22371 (Vwf)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   22371 (Vwf)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22371 (Vwf)
SSDB
Motif
Pfam: VWD VWA C8 VWA_N2 TIL VWA_2 VWC Pacifastin_I
Other DBs
NCBI-GeneID: 22371
NCBI-ProteinID: NP_035838
MGI: 98941
Ensembl: ENSMUSG00000001930
Vega: OTTMUSG00000022190
UniProt: Q8CIZ8 E9QPU1
Structure
PDB: 
1U0O

Position
6 F3; 6 59.32 cM
AA seq 2813 aa
MNPFRYEICLLVLALTWPGTLCTEKPRDRPSTARCSLFGDDFINTFDETMYSFAGGCSYL
LAGDCQKRSFSILGNFQDGKRMSLSVYLGEFFDIHLFANGTVTQGDQSISMPYASQGLYL
EREAGYYKLSSETFGFAARIDGNGNFQVLMSDRHFNKTCGLCGDFNIFAEDDFRTQEGTL
TSDPYDFANSWALSSEEQRCKRASPPSRNCESSSGDMHQAMWEQCQLLKTASVFARCHPL
VDPESFVALCEKILCTCATGPECACPVLLEYARTCAQEGMVLYGWTDHSACRPACPAGME
YKECVSPCPRTCQSLSINEVCQQQCVDGCSCPEGELLDEDRCVQSSDCPCVHAGKRYPPG
TSLSQDCNTCICRNSLWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCED
HTFSIVIETMQCADDPDAVCTRSVSVRLSALHNSLVKLKHGGAVGIDGQDVQLPFLQGDL
RIQHTVMASVRLSYAEDLQMDWDGRGRLLVKLSPVYSGKTCGLCGNYNGNKGDDFLTPAG
LVEPLVVDFGNAWKLQGDCSDLRRQHSDPCSLNPRLTRFAEEACALLTSSKFEACHHAVS
PLPYLQNCRYDVCSCSDSRDCLCNAVANYAAECARKGVHIGWREPGFCALGCPQGQVYLQ
CGNSCNLTCRSLSLPDEECSEVCLEGCYCPPGLYQDERGDCVPKAQCPCYYDGELFQPAD
IFSDHHTMCYCEDGFMHCTTSGTLGSLLPDTVLSSPLSHRSKRSLSCRPPMVKLVCPADN
PRAQGLECAKTCQNYDLECMSLGCVSGCLCPPGMVRHENKCVALERCPCFHQGAEYAPGD
TVKIGCNTCVCRERKWNCTNHVCDATCSAIGMAHYLTFDGLKYLFPGECQYVLVQDYCGS
NPGTFQILVGNEGCSYPSVKCRKRVTILVDGGELELFDGEVNVKRPLRDESHFEVVESGR
YVILLLGQALSVVWDHHLSISVVLKHTYQEQVCGLCGNFDGIQNNDFTTSSLQVEEDPVN
FGNSWKVSSQCADTRKLSLDVSPATCHNNIMKQTMVDSACRILTSDVFQGCNRLVDPEPY
LDICIYDTCSCESIGDCACFCDTIAAYAHVCAQHGQVVAWRTPTLCPQSCEEKNVRENGY
ECEWRYNSCAPACPVTCQHPEPLACPVQCVEGCHAHCPPGRILDELLQTCVDPQDCPVCE
VAGRRLAPGKKITLSPDDPAHCQNCHCDGVNLTCEACQEPGGLVAPPTDAPVSSTTPYVE
DTPEPPLHNFYCSKLLDLVFLLDGSSMLSEAEFEVLKAFVVGMMERLHISQKRIRVAVVE
YHDGSRAYLELKARKRPSELRRITSQIKYTGSQVASTSEVLKYTLFQIFGKIDRPEASHI
TLLLTASQEPPRMARNLVRYVQGLKKKKVIVIPVGIGPHASLKQIRLIEKQAPENKAFLL
SGVDELEQRRDEIVSYLCDLAPEAPAPTQPPQVAHVTVSPGIAGISSPGPKRKSMVLDVV
FVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEE
VLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLP
GDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLVLQTCCSKEGLQLPTL
PPLPDCSQPLDVVLLLDGSSSLPESSFDKMKSFAKAFISKANIGPHLTQVSVIQYGSINT
IDVPWNVVQEKAHLQSLVDLMQQEGGPSQIGDALAFAVRYVTSQIHGARPGASKAVVIII
MDTSLDPVDTAADAARSNRVAVFPVGVGDRYDEAQLRILAGPGASSNVVKLQQVEDLSTM
ATLGNSFFHKLCSGFSGVCVDEDGNEKRPGDVWTLPDQCHTVTCLANGQTLLQSHRVNCD
HGPRPSCANSQSPVRVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVIFQNK
EQDLEVLLHNGACSPGAKQACMKSIEIKHAGVSAELHSNMEMAVDGRLVLAPYVGENMEV
SIYGAIMYEVRFTHLGHILTYTPQNNEFQLQLSPKTFASKMHGLCGICDENGANDFTLRD
GTVTTDWKRLVQEWTVQQPGYTCQAVPEEQCPVSDSSHCQVLLSASFAECHKVIAPATFH
TICQQDSCHQERVCEVIASYAHLCRTSGVCVDWRTTDFCAMSCPPSLVYNHCERGCPRHC
DGNTSFCGDHPSEGCFCPQHQVFLEGSCVPEEACTQCVGEDGVRHQFLETWVPDHQPCQI
CMCLSGRKINCTAQPCPTARAPTCGPCEVARLKQSTNLCCPEYECVCDLFNCNLPPVPPC
EGGLQPTLTNPGECRPTFTCACRKEECKRVSPPSCPPHRTPTLRKTQCCDEYECACSCVN
STLSCPLGYLASATTNDCGCTTTTCLPDKVCVHRGTVYPVGQFWEEGCDTCTCTDMEDTV
VGLRVVQCSQRPCEDSCQPGFSYVLHEGECCGRCLPSACKVVAGSLRGDSHSSWKSVGSR
WAVPENPCLVNECVRVEDAVFVQQRNISCPQLAVPTCPTGFQLNCETSECCPSCHCEPVE
ACLLNGTIIGPGKSVMVDLCTTCRCIVQTDAISRFKLECRKTTCEACPMGYREEKSQGEC
CGRCLPTACTIQLRGGRIMTLKQDETFQDGCDSHLCRVNERGEYIWEKRVTGCPPFDEHK
CLAEGGKIVKIPGTCCDTCEEPDCKDITAKVQYIKVGDCKSQEEVDIHYCQGKCASKAVY
SIDIEDVQEQCSCCLPSRTEPMRVPLHCTNGSVVYHEVINAMQCRCSPRNCSK
NT seq 8442 nt   +upstreamnt  +downstreamnt
atgaaccctttcaggtatgagatctgcctgcttgttctggccctcacctggccagggacc
ctctgcacagaaaagccccgtgacaggccgtcgacggcccgatgcagcctctttggggac
gacttcatcaacacgtttgatgagaccatgtacagctttgcagggggctgcagttatctc
ctggctggggactgccagaaacgttccttctccattctcgggaacttccaagatggcaag
agaatgagcctgtctgtgtatcttggggagttttttgacatccatttgtttgccaatggc
accgtaacgcagggtgaccaaagcatctccatgccctacgcctcccaaggactctaccta
gaacgcgaggctgggtactataagctctccagtgagacctttggctttgcggccagaatc
gatggcaatggcaacttccaagtcctgatgtcagacagacacttcaacaagacctgtggg
ctgtgcggtgattttaacatcttcgcggaagatgattttaggacgcaggaggggaccttg
acctcagacccctatgattttgccaactcctgggccctgagcagtgaggaacagcggtgt
aaacgggcatctcctcccagcaggaactgcgagagctcttctggggacatgcatcaggcc
atgtgggagcaatgccagctactgaagacggcatcggtgtttgcccgctgccaccctctg
gtggatcccgagtcctttgtggctctgtgtgagaagattttgtgtacgtgtgctacgggg
ccagagtgcgcatgtcctgtactccttgagtatgcccgaacctgcgcccaggaagggatg
gtgctgtacggctggactgaccacagtgcctgtcgtccagcttgcccagctggcatggaa
tataaggagtgtgtgtctccttgccccagaacctgccagagcctgtctatcaatgaagtg
tgtcagcagcaatgtgtagacggctgtagctgccctgagggagagctcttggatgaagac
cgatgtgtgcagagctccgactgtccttgcgtgcacgctgggaagcggtaccctcctggc
acctccctctctcaggactgcaacacttgtatctgcagaaacagcctatggatctgcagc
aatgaggaatgcccaggggagtgtcttgtcacaggccaatcgcacttcaagagcttcgac
aacaggtacttcaccttcagtgggatctgccaatatctgctggcccgggactgcgaggat
cacactttctccattgtcatagagaccatgcagtgtgccgatgaccctgatgctgtctgc
acccgctcggtcagtgtgcggctctctgccctgcacaacagcctggtgaaactgaagcac
gggggagcagtgggcatcgatggtcaggatgtccagctccccttcctgcaaggtgacctc
cgcatccagcacacagtgatggcttctgtacgcctcagctatgcggaggacctgcagatg
gactgggatggccgtgggcggctactggttaagctgtccccagtctattctgggaagacc
tgtggcttgtgtgggaattacaacggcaacaagggagacgacttcctcacgccggccggc
ttggtggagcccctggtggtagacttcggaaacgcctggaagcttcaaggggactgttcg
gacctgcgcaggcaacacagcgacccctgcagcctgaatccacgcttgaccaggtttgca
gaggaggcttgtgcgctcctgacgtcctccaagttcgaggcctgccaccacgcagtcagc
cctctgccctatctgcagaactgccgttatgatgtttgctcctgctccgacagccgggat
tgcctgtgtaacgcagtagctaactatgctgccgagtgtgcccgaaaaggcgtgcacatc
gggtggcgggagcctggcttctgtgctctgggctgtccacagggccaggtgtacctgcag
tgtgggaattcctgcaacctgacctgccgctccctctccctcccggatgaagaatgcagt
gaagtctgtcttgaaggctgctactgcccaccagggctctaccaggatgaaagaggggac
tgtgtgcccaaggcccagtgcccctgctactacgatggtgagctcttccagcctgcggac
attttctcagaccaccataccatgtgttactgtgaagatggcttcatgcactgtaccaca
agtggcaccctggggagcctgttgcctgacactgtcctcagcagtcccctgtctcaccgt
agcaaaaggagcctttcctgccggccacccatggtcaagctggtgtgtcctgctgacaac
ccacgggctcaagggctggagtgtgctaagacgtgccagaactacgacctggagtgtatg
agcctgggctgtgtgtctggctgcctctgtcccccaggcatggtccggcacgaaaacaag
tgtgtggccttggagcggtgtccctgcttccatcagggtgcagagtacgccccgggagac
acagtgaagattggctgcaacacctgtgtctgccgggagcggaagtggaactgcacgaac
catgtgtgtgacgccacttgctctgccattggtatggcccactacctcaccttcgatgga
ctcaagtacctgttcccgggggagtgccagtatgttctggtgcaggattactgtggcagt
aaccctgggacctttcagatcctggtgggaaatgagggttgcagctatccctcggtgaag
tgcaggaagcgggtgaccatcctggtggatggaggggagcttgaactgtttgacggagag
gtgaacgttaagaggcccctgagagatgaatctcactttgaggtggtggagtcgggccgg
tacgtcatcctgctgctgggtcaggccctttctgtggtctgggaccaccacctcagcatc
tctgtggtcctgaagcacacataccaggaacaggtgtgtggcctctgcgggaactttgat
ggcatccagaacaatgacttcaccactagcagcctccaggtggaggaagaccccgtcaac
tttgggaactcctggaaagtgagctcacagtgtgctgacacgagaaagctgtcactagat
gtttcccctgccacttgccacaacaacatcatgaaacagacgatggtggactcagcctgc
agaatccttaccagtgacgtcttccagggctgcaacaggctggtggaccctgagccatac
ctggacatctgtatttatgacacttgctcctgtgagtccatcggggactgcgcctgtttc
tgtgacaccattgctgcctatgcccacgtgtgtgcccagcatggccaggtggtagcctgg
aggacacccacactgtgcccccagagctgtgaagaaaagaatgttcgggaaaatggctat
gagtgtgagtggcgttataacagctgtgcgcctgcttgcccagtcacgtgtcagcaccct
gagcctctggcttgccctgtgcagtgtgtggagggttgtcatgcacattgccctccaggg
agaatcctggatgaacttctgcagacctgcgtagacccccaagactgccccgtgtgtgag
gtggctggtcggcgcttggctcctggaaagaaaatcaccttgagtcctgatgaccctgca
cactgtcagaattgtcactgtgatggtgtgaaccttacgtgtgaagcctgccaagagccc
ggaggcctggtggcacccccaactgatgccccagtcagctctaccaccccatatgttgag
gatacccccgagccccccctgcacaacttctactgcagcaagctgctggatcttgtcttc
ctgctggatggctcctctatgttgtccgaggctgagtttgaagtgctcaaagcttttgtg
gtgggcatgatggagaggttacacatctctcagaagcgcatccgcgtggcagtggtagag
taccatgatggctcccgtgcctaccttgagctcaaggcccggaagcgaccctcagagctt
cggcgcatcaccagccagattaagtatacaggcagccaggtggcctctaccagtgaggtt
ttgaagtacacactgttccagatctttggcaaaattgaccgccctgaagcctcccatatc
actctgctcctgactgctagccaggagcccccacggatggctaggaatttggtccgctat
gtccaaggtctgaagaagaagaaggttatcgtgatccctgtgggcattgggccccacgcc
agcctcaaacagatccgcctcatcgagaagcaggcccctgaaaacaaggcttttctgctc
agtggggtggatgagctggagcagagaagagatgagatagtcagctacctctgtgacctt
gctcccgaggccccagccccaactcagcctccacaggtagcccacgtcaccgtgagtcca
gggatcgctgggatctcgtcaccgggaccaaaacggaagtccatggttctggatgtggtg
tttgtcctggaggggtcagacgaagttggtgaagccaacttcaataagagcaaggagttc
gtggaggaggtaatccagcgcatggacgtgagcccggatgcaacgcgcatctcagtactg
cagtattcctacacggtaaccatggagtatgccttcaatggggcccagtccaaggaggag
gtgctgcggcacgtgcgagagatccgctaccagggcggcaataggacaaacactgggcag
gccctgcagtacctttctgagcacagcttctctcccagccaaggggaccgggtagaggca
cctaacctggtctacatggtcacggggaaccccgcctctgatgagatcaagaggttgcct
ggagacatccaggtggtacccattggggtgggcccccatgccaacatgcaggaactggag
aggatcagcaggcccatcgctcccatcttcatccgggactttgagacacttccccgagag
gctcctgacctggtcctgcagacatgttgctccaaggagggtctgcaactgcccaccctc
ccccctctccctgactgcagccaacccctggatgtggtcctgctcctggatggctcctct
agcttgccagagtcttcctttgataaaatgaagagttttgccaaggctttcatttcaaag
gccaacattgggccccacctcacacaggtgtccgtgatacagtatggaagcatcaatacc
attgatgtaccatggaatgtggttcaggagaaagcccatctacagagtttggtggacctc
atgcagcaggagggtggccccagccagattggggatgctctggcctttgccgtgcgctat
gtaacttcacaaatccacggagccaggcctggggcctccaaagcagtggtcatcatcatc
atggatacctccttggatcccgtggacacagcagcagatgctgccagatccaaccgagtg
gcagtgtttcccgttggggttggggatcggtatgatgaagcccagctgaggatcttggca
ggccctggggccagctccaatgtggtaaagctccagcaagttgaagacctctccaccatg
gccaccctgggcaactccttcttccacaaactgtgttctgggttttctggagtttgtgtg
gatgaagatgggaatgagaagaggcctggggatgtctggaccttgccggatcagtgccac
acagtgacttgcttggcaaatggccagaccttgctgcagagtcatcgtgtcaattgtgac
catggaccccggccttcatgtgccaacagccagtctcctgttcgggtggaggagacgtgt
ggctgccgctggacctgcccttgtgtgtgcacgggcagttccactcggcacatcgtcacc
ttcgatgggcagaatttcaagcttactggtagctgctcctatgtcatctttcaaaacaag
gagcaggacctggaagtgctcctccacaatggggcctgcagccccggggcaaaacaagcc
tgcatgaagtccattgagattaagcatgctggcgtctctgctgagctgcacagtaacatg
gagatggcagtggatgggagactggtccttgccccgtacgttggtgaaaacatggaagtc
agcatctacggcgctatcatgtatgaagtcaggtttacccatcttggccacatcctcaca
tacacgccacaaaacaacgagttccaactgcagcttagccccaagacctttgcttcgaag
atgcatggtctttgcggaatctgtgatgaaaacggggccaatgacttcacgttgcgagat
ggcacggtcaccacagactggaaaaggcttgtccaggaatggacggtgcagcagccaggg
tacacatgccaggctgttcccgaggagcagtgtcccgtctctgacagctcccactgccag
gtcctcctctcagcgtcgtttgctgaatgccacaaggtcatcgctccagccacattccat
accatctgccagcaagacagttgccaccaggagcgagtgtgtgaggtgattgcttcttac
gcccatctctgtcggaccagtggggtctgtgttgattggaggacaactgatttctgtgct
atgtcatgcccaccgtccctggtgtataaccactgtgagcgtggctgccctcggcactgc
gatgggaacactagcttctgtggggaccatccctcagaaggctgcttctgtccccaacac
caagtttttctggaaggcagctgtgtccccgaggaggcctgcactcagtgtgttggcgag
gatggagttcgacatcagttcctggagacctgggtcccagaccatcagccctgtcagatc
tgtatgtgcctcagtgggagaaagattaactgcactgcccagccgtgtcccacagcccga
gctcccacgtgtggcccatgtgaagtggctcgcctcaagcagagcacaaacctgtgctgc
ccagagtatgagtgtgtgtgtgacctgttcaactgcaacttgcctccagtgcctccgtgt
gaaggagggctccagccaaccctgaccaaccctggagaatgcagacccacctttacctgt
gcctgcaggaaagaagagtgcaaaagagtgtccccaccctcctgcccccctcaccggaca
cccactctccggaagacccagtgctgtgatgaatacgagtgtgcttgcagctgtgtcaac
tccacgctgagctgcccacttggctacctggcctcagccactaccaatgactgtggctgc
accacgaccacctgtctccctgacaaggtttgtgtccaccgaggcaccgtctaccctgtg
ggccagttctgggaggagggctgtgacacgtgcacctgtacggacatggaggatactgtc
gtgggcctgcgtgtggtccagtgctctcaaaggccctgtgaagacagctgtcagccaggt
ttttcttatgttctccacgaaggcgagtgctgtggaaggtgcctgccctctgcttgcaag
gtggtggctggctcactgcggggcgattcccactcttcctggaaaagtgttggatctcgg
tgggctgttcctgagaacccctgcctcgtcaacgagtgtgtccgcgtggaggatgcagtg
tttgtgcagcagaggaacatctcctgcccacagctggctgtccctacctgtcccacaggc
ttccaactgaactgtgagacctcagagtgctgtcctagctgccactgtgagcctgtggag
gcctgcctgctcaatggcaccatcattgggcccgggaagagtgtgatggttgacctatgc
acgacctgccgctgcatcgtgcagacagacgccatctccagattcaagctggagtgcagg
aagactacctgtgaggcctgccccatgggctatcgggaagagaagagccagggtgaatgc
tgtgggagatgcttgcctacagcttgcactattcagctaagaggaggacggatcatgacc
ctgaagcaagatgagacattccaggatggctgtgacagtcatttgtgcagggtcaacgag
agaggagagtacatctgggagaagagggtcacgggctgcccaccatttgatgaacacaag
tgtctggctgaaggaggcaaaatcgtgaaaattccaggcacctgctgtgacacatgtgag
gagcctgattgcaaagacatcacagccaaggtgcagtacatcaaagtgggagattgtaag
tcccaagaggaagtggacattcattactgccagggaaagtgtgccagcaaagctgtgtac
tccattgacatcgaggatgtgcaggagcaatgctcctgctgcctgccctcgaggacggag
cccatgcgcgtgcccttgcactgcaccaatggctctgtcgtgtaccacgaggtcatcaac
gccatgcagtgcaggtgttctccccggaactgcagcaagtga

KEGG   Mus musculus (mouse): 226519
Entry
226519            CDS       T01002                                 

Gene name
Lamc1, Lam, Lamb2
Definition
(RefSeq) laminin, gamma 1
  KO
K05635  laminin, gamma 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05020  Prion disease
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    226519 (Lamc1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    226519 (Lamc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    226519 (Lamc1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    226519 (Lamc1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    226519 (Lamc1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    226519 (Lamc1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    226519 (Lamc1)
   05145 Toxoplasmosis
    226519 (Lamc1)
  09164 Neurodegenerative disease
   05020 Prion disease
    226519 (Lamc1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 226519
NCBI-ProteinID: NP_034813
MGI: 99914
Ensembl: ENSMUSG00000026478
Vega: OTTMUSG00000030992
UniProt: F8VQJ3
Structure
PDB: 
1KLO 5MC9 1NPE 4AQT 1TLE

Position
1 G3; 1 65.3 cM
AA seq 1607 aa
MTGGGRAALALQPRGRLWPLLAVLAAVAGCVRAAMDECADEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDK
LMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCRDNTDGAKCERCRENFFRLGNTEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSTDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPKGCTPCFCFGHSSVCTNAVGYSVYDISSTFQIDEDGWRVEQRDGSEASLEWSS
DRQDIAVISDSYFPRYFIAPVKFLGNQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYIFRLHEATDYPWRPALSPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLQSARPGPGVPATWVESCTCPVGYGGQFCETCLPGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCDCRDNTAGPHCEKCSDGYYGDSTLGTSSDCQPCPCPGGSSCA
IVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVT
GQCQCLPHVSGRDCGTCDPGYYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCETNHFGFGPEGCKPCDCHHEGSLSLQCKEDGRCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVAEHRVKLQELESLIANLGTGDDMVTDQAFEDRLKEAEREV
TDLLREAQEVKDVDQNLMDRLQRVNSSLHSQISRLQNIRNTIEETGILAERARSRVESTE
QLIEIASRELEKAKMAAANVSITQPESTGEPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANETSAEAYNLLLRTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLTPVDSEALENEANKIKKEAADLDRLIDQKLKDYEDLREDMRGKEHEVK
NLLEKGKAEQQTADQLLARADAAKALAEEAAKKGRSTLQEANDILNNLKDFDRRVNDNKT
AAEEALRRIPAINRTIAEANEKTREAQLALGNAAADATEAKNKAHEAERIASAVQKNATS
TKADAERTFGEVTDLDNEVNGMLRQLEEAENELKKKQDDADQDMMMAGMASQAAQEAELN
ARKAKNSVSSLLSQLNNLLDQLGQLDTVDLNKLNEIEGSLNKAKDEMKASDLDRKVSDLE
SEARKQEAAIMDYNRDIAEIIKDIHNLEDIKKTLPTGCFNTPSIEKP
NT seq 4824 nt   +upstreamnt  +downstreamnt
atgacgggcggcgggcgggccgcgctggccctgcagccccgggggcggctgtggccgctg
ttggctgtgctggcggctgtggcgggctgtgtccgggcggccatggacgagtgcgcggat
gagggcgggcggccgcagcgctgcatgccggagtttgttaatgccgccttcaatgtgacc
gtggtggctaccaacacgtgtgggactccgcccgaggagtactgcgtgcagactggggtg
accggagtcactaagtcctgtcacctgtgcgacgccggccagcagcacctgcaacacggg
gcagccttcctgaccgactacaacaaccaggccgacaccacctggtggcaaagccagact
atgctggccggggtgcagtaccccaactccatcaacctcacgctgcacctgggaaaggct
tttgacatcacttacgtgcgcctcaagttccacaccagccgtccagagagcttcgccatc
tataagcgcactcgggaagacgggccctggattccttatcagtactacagtgggtcctgt
gagaacacgtactcaaaggctaaccgtggcttcatcaggaccggaggggacgagcagcag
gccttgtgtactgatgaattcagtgacatttcccccctcaccggtggcaacgtggccttt
tcaaccctggaaggacggccgagtgcctacaactttgacaacagccctgtgctccaggaa
tgggtaactgccactgacatcagagtgacgctcaatcgcctgaacacctttggagatgaa
gtgtttaacgaccccaaagttctcaagtcttactattacgcaatctcagactttgctgtg
ggcggcaggtgtaaatgtaacggacatgccagcgagtgtgtaaagaacgagtttgacaaa
ctcatgtgcaactgcaaacataacacatacggagttgactgtgaaaagtgcctgcctttc
ttcaatgaccggccgtggaggagggcgactgctgagagcgccagcgagtgccttccttgt
gactgcaatggccgatcccaagagtgctactttgatcctgaactataccgttccactgga
catggtggccactgtaccaactgccgggataacacagatggtgccaagtgcgagaggtgc
cgggagaatttcttccgcctggggaacactgaagcctgctctccgtgccactgcagccct
gttggttctctcagcacacagtgtgacagttacggcagatgcagctgtaagccaggagtg
atgggtgacaagtgtgaccgttgtcagcctgggttccattccctcactgaggcaggatgc
aggccatgctcctgcgatccttcgggcagcacagacgagtgtaatgttgaaacaggaaga
tgcgtttgcaaagacaatgttgaaggcttcaactgtgagagatgcaaacctggatttttt
aatctggagtcatctaatcctaagggctgcacaccctgcttctgctttggccattcttct
gtgtgcacaaatgctgttggctacagtgtttatgacatctcctccacctttcagattgat
gaggatgggtggcgcgtggagcagagagatggctcggaggcgtctctggagtggtcctca
gacaggcaagatattgccgtaatctcagacagttactttcctagatacttcatcgcccct
gtgaagttcctgggcaaccaggtcctgagttatgggcagaatctttccttctccttccga
gtggacagacgagacactcgcctctccgcagaggaccttgtgctcgaaggagctggcttg
agagtatccgtgcccttgatcgctcagggcaactcctaccccagcgagaccactgtgaag
tacatcttcaggctccatgaagcaacggattacccttggaggcccgctctctccccgttt
gaatttcagaagctcctgaacaacttgacctctatcaagatccgtggtacatacagcgag
aggagcgctgggtacttggatgatgtcaccttgcaaagtgctcgccctgggcccggagtc
cctgcaacgtgggtggagtcctgcacctgtccagtgggatacgggggacagttctgtgag
acgtgcctcccagggtacagaagagaaactccaagccttggaccttatagcccgtgtgtg
ctctgtacctgtaatgggcacagtgagacctgtgacccggagacaggtgtctgtgactgc
agagacaatacagccggcccccactgtgagaaatgtagcgatgggtactatggggactca
accctgggcacctcctctgactgccagccttgtccctgccccggtggctcaagttgtgcc
attgtcccaaagacaaaggaagtggtgtgcacgcactgtccgactggcactgccggcaag
agatgtgaactctgtgatgacggctactttggagaccctctgggcagcaatgggcctgtg
agactgtgccgcccgtgccagtgtaacgacaacatagaccccaacgcggttggcaactgc
aaccgcctgacgggcgagtgcctgaagtgcatctataacacggctggtttctactgcgac
cggtgcaaggaagggtttttcggaaatcccctggctcccaatccagccgacaaatgcaaa
gcctgcgcctgcaatccctacgggacagtgcagcaacagagcagctgtaacccggtgacc
ggacagtgccagtgtctgcctcatgtgtctggccgcgactgcggtacttgtgaccctggc
tactacaacctgcagagcgggcaaggctgcgagaggtgtgactgccatgctttgggttcc
accaatgggcagtgtgacatccgcaccgggcagtgtgagtgccagcctggcatcaccggc
cagcactgtgagcgctgtgagaccaaccactttgggtttggacctgaaggctgcaaacct
tgtgactgtcaccatgaaggatccctttcactccagtgtaaagaggacggccgttgtgaa
tgcagggaaggctttgtgggcaatcgctgtgaccagtgtgaagagaactatttctacaat
cggtcctggcctggctgccaggagtgtccggcttgttaccgactggtgaaggataaggtt
gctgagcatcgagtgaaactccaggagttagagagcctcatcgccaaccttggcactggg
gatgacatggtgacagatcaagcctttgaggacagacttaaggaagcagaaagggaggtg
acagaccttctccgtgaggctcaggaagtcaaagatgtagatcaaaatctgatggatcgc
cttcagagagtaaatagcagcctgcatagccaaattagccgactgcagaatatccggaat
actatcgaagagaccgggatcttggctgagcgagcacggtcccgagtggagagtacagag
cagctgattgagatcgcctccagggagctcgagaaagcaaaaatggctgccgccaatgtg
tcaatcactcagccagagtctacaggggagccaaacaacatgaccctcttggcagaagaa
gcccgaaagcttgcagagcgtcataaacaggaagccgatgacattgtacgagtggcaaag
acagccaacgagacttcagctgaggcatataatctgcttttgaggaccctggcaggagaa
aatcaaactgcgctggagattgaagaacttaaccggaagtatgaacaagcaaagaacatc
tctcaggacctggagaagcaggctgcccgagtccatgaggaagccaagcgtgcaggtgac
aaagccgtagagatctatgccagtgtggcccagctgacccctgtggactctgaggccctg
gagaatgaagcaaataaaatcaagaaagaagctgcagacctggaccgtctgattgaccag
aagctaaaggattacgaggacctcagggaagacatgagaggaaaggaacatgaagtgaag
aaccttctagagaaggggaaagctgaacagcagaccgccgaccaactcctagctcgagcc
gatgctgccaaggcccttgctgaagaagctgctaagaagggacgcagtaccttacaagaa
gccaatgacattctcaacaacctgaaagattttgatagacgcgtgaacgataacaagaca
gccgcggaagaagctctaaggagaattcccgccatcaaccggaccatagctgaagccaat
gagaagacaagggaggcccagctagcgctgggcaatgctgccgctgacgccacggaggcc
aagaacaaggcccatgaggcagagaggattgccagcgccgtgcagaagaatgccaccagt
accaaggcggacgcagaaagaaccttcggggaagttacagatctggataatgaggtgaat
ggtatgctgaggcagctggaggaggcagagaatgagctgaagaagaagcaagatgatgcc
gaccaggacatgatgatggcagggatggcttcgcaggctgctcaggaggctgagctcaat
gccagaaaggccaaaaactctgtcagcagcctcctcagccagctgaacaacctcttggat
cagctaggacagctggacacagtggacctgaacaagctcaatgagatcgaaggctccctg
aacaaagccaaagacgaaatgaaggccagcgacctggacaggaaggtgtctgacctggag
agcgaggctcggaagcaggaggcagccatcatggactataaccgggacatagcagagatc
attaaggatattcacaacctggaggacatcaagaagaccctaccaaccggctgcttcaac
accccgtccatcgagaagccctag

KEGG   Mus musculus (mouse): 23928
Entry
23928             CDS       T01002                                 

Gene name
Lamc3, 1110064A23, 1110064A23Rik, AI562206, AW240805
Definition
(RefSeq) laminin gamma 3
  KO
K06247  laminin, gamma 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    23928 (Lamc3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    23928 (Lamc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    23928 (Lamc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23928 (Lamc3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    23928 (Lamc3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    23928 (Lamc3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    23928 (Lamc3)
   05145 Toxoplasmosis
    23928 (Lamc3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B XhlA
Other DBs
NCBI-GeneID: 23928
NCBI-ProteinID: NP_035966
MGI: 1344394
Ensembl: ENSMUSG00000026840
Vega: OTTMUSG00000012245
UniProt: Q9R0B6
Position
2; 2 B
AA seq 1581 aa
MAVSRVLSLLATVASMALVIQETHFAAGADMGSCYDGVGRAQRCLPEFENAAFGRRAEAS
HTCGRPPEDFCPHVGAPGAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTY
GRPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDILISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACR
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCDNSGVCPCKPTVTGWK
CDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQP
HNPVGCSSCFCYGHSKVCSPAAGFQEHHIRSDFRHGAGGWQIRSMGVSKRPLQWSQSGLL
LGLRGGEELSAPKKFLGDQRLSYGQPVILTLQVPPGGSPPPIQLRLEGAGLALSLRPSSL
PSPQDTRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVL
LCEVQLTSAWPQRELAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYANCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPGQSACATIPE
SGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHS
GHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVC
LPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASSQCHENSTCVCRPGFVGYKCDRCQDNFFLADGDTG
CQECPTCYALVKEEAAKLKARLMLMEGWLQRSDCGSPWGPLDILQGEAPLGDVYQGHHLL
QETRGTFLQQMVGLEDSVKATWEQLQVLRGHVHCAQAGAQKTCIQLAELEETLQSSEEEV
LRAASALSFLASLQKGSSTPTNWSHLASEAQILARSHRDTATKIEATSERALLASNASYE
LLKLMEGRVASEAQQELEDRYQEVQAAQTALGIAVAEALPKAEKALATVKQVIGDAAPHL
GLLVTPEAMNFQARGLSWKVKALEQKLEQKEPEVGQSVGALQVEAGRALEKMEPFMQLRN
KTTAAFTRASSAVQAAKVTVIGAETLLADLEGMKLRSPLPKEQAALKKKAGSIRTRLLED
TKRKTKQAERMLGNAASLSSSTKKKSKEAELMSKDNAKLSRALLREGKQGYRHASRLASQ
TQATLRRASRLLLTSEAHKQELEEAKQVTSGLSTVERQIRESRISLEKDTKVLSELLVKL
GSLGVHQAPAQTLNETQRALESLRLQLDSHGALHHKLRQLEEESARQELQIQSFEDDLAE
IRADKHNLETILSSLPENCAS
NT seq 4746 nt   +upstreamnt  +downstreamnt
atggctgtatccagggtcctgtccctcctggcaacggtggcatcgatggcgctggtgatt
caggagacacacttcgcggcaggcgcggacatgggctcttgctacgacggtgtgggacgc
gcacagcgctgtctgcctgagttcgagaacgcggcgttcggccgacgcgccgaggcctcc
cacacgtgcggacggcccccggaggacttctgtccacacgtgggggcaccaggggctggg
ctacagtgccagcgctgcgacgatgctgaccccggacgacgccacgacgcctcctacctc
acagacttccacagccccgatgacagcacctggtggcagagcccatccatggccttcggg
gtgcagtaccccacctctgttaacctgaccttgagcttagggaaggcctatgagattacc
tatgtgaggctgaagttccacaccagtcgccctgagagttttgccatctacaagcgcacg
tacgccagtggcccctgggagccctaccaatactacagtgcctcctgccagaaaacctat
ggccgtcctgagggccactacctgcgaccgggcgaggatgagagggtggccttctgcacc
tctgagttcagtgacatctcccccttgaacgggggcaacgtggccttctccaccctggaa
ggccgtcccagtgcctacaactttgaggagagccctgtgctgcaggagtgggtcaccagc
actgacatcctgatctctctagatcggctcaacacgtttggggatgacatcttcaaggac
cccagagtgctccagtcttactactacgctgtgtctgacttctctgtgggtggcaggtgc
aaatgcaatggtcacgccagtgaatgcgaacccaatgcggctggtcagctggcttgccgc
tgtcagcacaacaccacaggagtggactgcgagcgttgtctgcccttcttccaggaccgt
ccgtgggcccgaggcaccgccgaggatgccaacgagtgtctgccctgcaactgcagtggg
cactctgaggagtgcacgtttgacagggagctctatcggagcacaggccatggtgggcac
tgtcagcggtgccgtgaccacacaactgggccacactgtgagcgctgtgagaagaactac
tacagatggtccccgaagacaccatgccaaccctgtgactgccacccagcaggctctctg
agtctccagtgtgacaactcaggcgtctgtccctgcaagcccacagtgacaggctggaag
tgtgatcgctgcctgcctggattccactcactcagtgagggcggctgcagaccctgtgcc
tgcaatgtcgccggcagcttgggcacctgtgacccccgcagtgggaactgtccctgcaaa
gagaatgtagaaggcagcctgtgtgacagatgccgccctgggacatttaacctgcagccc
cacaatccagtgggctgcagcagctgcttctgttatggccactccaaggtgtgttctcct
gctgccgggttccaggaacaccacatccgctcagacttccgccatggagctggtggctgg
cagatcagaagcatgggagtgtccaagcgtcctctgcaatggagccagagtgggctcctc
ctgggcctgcgaggaggggaggaactctcagccccaaagaagttcctgggagaccagaga
ctcagctatggacagccagtcatactgaccctccaagtaccccctggaggctccccacct
cctattcagctgagactggagggagcaggcttggctctgtctctgaggccctccagtcta
cccagccctcaggacaccaggcagccaagacgagttcagctccagttcctcttgcaggag
acttctgaggaggcagagtccccactgcccaccttccacttccagcgcctgctttccaat
ctgactgctctgagcatctggaccagtggccaaggaccgggccattctggccaagtgctc
ttgtgtgaagttcagctcacatcggcctggccccagcgtgagcttgcccctccagcctct
tgggtggagacctgcttatgtccccagggatacacaggccagttctgtgaattctgtgct
ctgggatacaagagagaaatacctcatgggggtccctatgccaactgcattccctgcacc
tgcaaccagcatggcacctgtgaccccaacacagggatctgcctgtgtggccaccacacc
gagggtccatcctgtgagcggtgcatgccaggtttctacggtaacgccttctcaggccgt
gctgatgattgccagccctgtccgtgccctggccaatcagcctgtgcaaccatcccagag
agtggagatgtggtgtgcacacactgccctcctggtcagagaggacgacgatgcgagagc
tgcgaagatggcttttttggggatcctctagggctctctggagctccccagccctgccgc
cgatgccagtgcagcgggaacgtggatctcaatgctgtgggcaactgtgatcctcattct
ggccactgcttgcgctgtctgtacaacacgacaggggcccactgcgagcactgtcgggag
ggtttctacgggagtgccgtggccacaaggcccgtggacaaatgtgctccctgcagctgt
gacctgaggggctcagtcagtgagaagacctgcaaccctgtgactggccagtgtgtctgc
ctgccttatgtctccgggagggactgcagccgctgcagccctggcttctatgacctccag
tctgggaggggctgccagagctgcaaatgtcacccacttggatccttggagaataagtgc
caccccaagactggccagtgtccctgccgacctggtgtcactggccaagcctgtgacaga
tgccagctaggtttctttggcttctccatcaagggctgccgagactgtaggtgctcccca
ttgggtgctgcctcatctcagtgccatgagaacagcacctgtgtgtgccggcccggcttt
gtgggctataaatgcgaccgctgccaggacaatttcttcctcgcggatggcgacacaggc
tgccaagagtgtcccacttgctatgccctagtgaaggaagaggcagccaagctgaaggcc
aggttgatgctgatggaggggtggcttcaaaggtctgactgtggtagcccctggggacca
ctagacattctgcagggagaagcccctctgggggatgtctaccaaggtcaccacctactt
caagagacccgggggaccttcctgcagcagatggtgggcctggaggattctgtgaaggcc
acttgggagcagttgcaggtgctgagagggcatgtacactgtgcccaggctggagctcag
aagacctgcatccagctggcagagctggaggagacattgcagtcctcagaggaggaggtc
cttcgtgcagcctcagctctctcatttctggcaagtcttcagaaaggatccagcacaccc
accaattggagtcacctggcatcagaggcccagatccttgccagaagccacagggacacg
gccaccaagatcgaagctacctcggaaagggccctgctcgcctccaacgccagctatgag
ctcctgaagctgatggaaggcagagtggcctcggaagcccagcaggaactggaggacagg
taccaggaggtgcaggcagctcagactgccctgggcatagctgtggcagaggcgctgccc
aaagctgaaaaggcactggccacggtgaagcaagtcattggtgacgcagccccacatcta
ggcttgctggtcacccctgaagcaatgaacttccaagccaggggcctgagctggaaagtg
aaggccctggagcagaagctggagcagaaggagcccgaggtgggccagtctgtgggagcc
ctgcaggtggaggctggaagagccttggagaagatggagccctttatgcagctacgcaat
aagaccacagctgccttcacacgggcttcctcagctgtgcaagctgccaaggtgaccgtc
ataggagcagagaccctgctagctgacctagagggaatgaagctgaggtctcctctaccc
aaggagcaggcagcgctgaagaagaaagcaggcagcatcaggaccaggctcctggaggac
acaaagaggaagaccaagcaggcagagaggatgctgggaaatgctgcctctctctcctcc
agcaccaagaagaaaagcaaagaagcagaactgatgtctaaggacaatgccaagctctcc
agagctttgctgagggaaggcaagcagggctaccgtcatgccagccgactcgccagccag
acccaggccacactccgtcgggcctctcgcctgctgctgacctcagaagcacacaagcag
gagctggaggaagctaaacaggtgacctctgggctgagcactgtggagcgccagatccga
gagtctcggatctccttggagaaggacaccaaggtcctgtcagagctgcttgtgaagctg
gggtccctgggtgtccaccaagcccctgctcagaccctgaacgagacccagcgggcacta
gaaagcttgaggctgcagctggattcccacggagccctgcatcacaaactgaggcagctg
gaggaagagtctgctcgacaggagctgcagattcagagctttgaggacgaccttgctgag
atccgcgctgacaagcacaacttggagaccattctgagcagtctgccagagaactgtgcc
agctag

KEGG   Mus musculus (mouse): 245026
Entry
245026            CDS       T01002                                 

Gene name
Col6a6, E330019B14, E330026B02Rik
Definition
(RefSeq) collagen, type VI, alpha 6
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    245026 (Col6a6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    245026 (Col6a6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    245026 (Col6a6)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    245026 (Col6a6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    245026 (Col6a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    245026 (Col6a6)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    245026 (Col6a6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   245026 (Col6a6)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   245026 (Col6a6)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   245026 (Col6a6)
SSDB
Motif
Pfam: VWA VWA_2 Collagen Integrin_beta
Other DBs
NCBI-GeneID: 245026
NCBI-ProteinID: NP_001096077
MGI: 2444259
Ensembl: ENSMUSG00000043719
Vega: OTTMUSG00000049418
UniProt: Q8C6K9
Position
9; 9 F1
AA seq 2265 aa
MLLVLCLTMICFHVCVNQDSGPEYADVVFLVDSSDHLGLKSFPLVKTFIHKMISSLPIEA
NKYRVALAQYSDALHNEFQLGTFKNRNPMLNHLKKNFGFIGGSLKIGNALQEAHRTYFSA
PTNGRDKKQFPPILVVLASAESEDDVEEAAKALREDGVKIISVGVQKASEENLKAMATSQ
FHFNLRTARDLSVFAPNMTEIIKDVTQYREGMADDIIVEACQGPSVADVVFLLDMAINGS
QEDLDHLKAFLGESISALDIKENCMRVGLVTYSNETRVISSLSTGNNKTEVLQRIQDLSP
QVGQAYTGAALRKTRKEIFSAQRGSRKNQGVPQIAVLVTHRASEDNVTKAAVNLRREGVT
IFTMGIEGANPDELEKIASHPAEQFTSKLGNFSELATHNQTFLKKLRNQITHTVSVFSER
TETLKSACVDTEEADIYLLIDGSGSTQPTDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYA
DTWDLEFEISKYSNKPDLGKAIENIRQMGGNTNTGAALNFTLKLLQRAKKERGSKVPCHL
VVLTNGMSRDSVLGPAHKLREENIRVHAIGVKEANQTQLREIAGEEKRVYYVHEFDALRN
IRNQVVQEICAEEACRDMKADIMFLVDSSGSIGPENFSKMKMFMKNLVSKSQIGADRVQI
GVVQFSHENKEEFQLNTFMSQSDIANAIDRMTHIGETTLTGSALTFVSQYFSPDKGARPN
VRKFLILITDGEAQDIVRDPAIALRKEGVIIYSVGVFGSNVTQLEEISGKPEMVFYVENF
DILQHIEDDLVLGICSPREECKRIEVLDVVFVIDSSGSIDYQEYNIMKDFMIGLVKKADV
GKNQVRFGALKYADDPEVLFYLDELGTKLEVVSVLQNDHPMGGNTYTAEALAFSDHMFTE
ARGSRLHKGVPQVLIVITDGESHDAEKLNTTAKALRDKGILVLAVGIAGANSWELLAMAG
SSDKYYFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFQKMKG
FLVSVVQDFDVSLNRVRIGVAQFSDSYRSEFLLGTFTGEREISTQIEGIQQIFGYTHIGD
ALRKVKYYFQPDMGSRINAGTPQVLLVLTDGRSQDEVAQAAEELRHKGVDIYSVGIGDVD
DQELVQITGTAEKKLTVHNFDELKKVKKRIVRNICTSGGESNCFVDVVVGFDISSLQRGQ
TLLEGQPWMGSYLQDLLRAISSLNGVSCEVGTETQVSIAFQVTNAMERYPSKFEIYSENI
LSSLQGVTVNGPSRLNANLLSSLWDTFQNKSAARGKVVLLFSDGLDDGIEKLEQKSDELR
KEGLNALITIAVDGAADSSDLADLLYIEFGKGFEYRTQFTIGMRNLGSQLSRQLINVAER
TCCCLLCKCTGGDGAMGDPGSAGKKGPPGFKGSDGYLGEEGIAGERGASGPMGEQGTKGC
FGAKGPKGTRGLSGEEGEVGEDGLDGLDGEQGDHGIPGRRGEKGDEGSQGNPGRRGAAGD
RGAKGLRGDPGTPGRDSSIQGPKGLKGDLGRQGRRGWPGSPGTPGSRRKMVVHGRRGHIG
PQGNPGTPGPDGLAGSPGLRGPQGPRGEVGEKGEKGSLGMKGPQGPPGPGGQAGSQGHLG
SQGNKGEPGDLGEKGAAGFPGPRGLQGDDGSPGYGSIGRKGTKGQEGFPGESGLKGDIGD
PGDPGEAGPKGARGKTVSAGIPGEPGSPGEPGPPGRKGVKGARGLASFSTCDLIQYVRDH
SPGRHGKPECPVHPTELVFVLDQSRDVTEQDFERMKGMMVSLVRDVKVREANCPVGARVA
ILAYNSHTRHLIRFSDAYRKDQLLTAIKALPYERSSDSREIGKAMRFISRNVFKRTLPGA
HVRRIATFFSSGPSADAQTITTAAMEFSALDIVPVVIAFSNVPSVKRAFSIDDTGTFQVI
VVPSGSDEGPALERLQRCTFCYDLCKPDASCDQAKPPPIQSYLDTAFLLDGSRHVGSAEF
EDMRDFLEALLDHFEITSEPETSVTGDRVALLSHAPLDFLPNTQRSPVRTEFNLTSYSSK
RLMKRHVDQAVQQLHGDAFLGHALGWALDNVFLNTPNLRRNKVIFVISAGETSHLDAETL
KKESLRAKCHGYALFVFSLGPDWDDKELEDLASHPVDQHLIQLGRIHKPDHGYSVKFVKS
FINSIRHGINKYPPVNLKAKCNRLGSRDLKPPPRQFRSFVPGPQKANLKDHTAEAAKLFQ
DKKRLSSMLKGGRATISSLSRSTRYAFKQGKEAIKATSKLGKRSA
NT seq 6798 nt   +upstreamnt  +downstreamnt
atgctgctggttttgtgcctgacaatgatttgtttccacgtgtgtgtgaaccaagattct
ggccccgagtacgcagacgtggtgtttctggtggacagctccgatcacctagggcttaag
tcctttcctcttgtgaaaactttcatccacaagatgatcagcagcctccccatagaggcc
aacaagtaccgcgtggccctggcccagtacagcgatgctctccacaatgagttccagctg
ggcaccttcaagaacaggaaccccatgctgaaccacctgaagaagaacttcgggttcatc
ggtggctccctgaagatagggaacgccctgcaggaggctcacaggacctatttctctgct
cccacaaatggaagagacaagaaacagttccccccaatcctggtggtgctggcttcagca
gagtctgaggatgatgtggaagaggctgcgaaggccctgcgggaagatggggtgaaaatc
atctctgtgggggtgcagaaggcttctgaggaaaacctgaaggcgatggccacctctcag
ttccatttcaatctcaggactgccagagacctcagcgtgtttgccccaaacatgacagag
atcatcaaggatgtgactcagtacagggaaggaatggcagatgacattattgtagaagcc
tgccaaggcccttctgtggctgatgtggtgttcctgttggatatggccatcaacggcagc
caggaggacctagatcatcttaaagcattcctgggcgaaagcatctctgccctggacata
aaggaaaattgcatgagggttggcctggtgacctatagcaatgagacaagggtgatcagc
tctctgagcacgggtaacaacaagacagaagtcttgcagcgcatacaggatctgtcccct
caagtagggcaggcctacactggagctgccctcagaaagactaggaaggaaatcttcagt
gcacagaggggcagtcggaagaaccaaggggtccctcagatcgctgtgctggtgacccac
agagcatcagaagacaacgtgaccaaggcagctgtcaacctccggcgggagggagtgacc
atctttaccatgggcatagagggggctaacccagacgagctggagaagatcgcatcccac
cctgcggagcagttcacctccaaactgggcaacttctctgagctggccacccacaaccag
acgttcctgaagaaactgcggaaccaaatcacacacacggtctctgtcttctcagaacgg
actgagaccctcaaatctgcctgtgtggacacagaggaagccgatatctatctactcatt
gatggttcagggagcacccagcccacagacttccatgaaatgaagaccttcctgtcagag
gtggtaggcatgttcaacattgctccccacaaggtgcgagtaggggccgtgcagtacgcc
gacacctgggacttggaatttgagatctctaagtatagtaacaagcctgacttgggaaag
gccatcgagaatatcaggcagatgggtgggaataccaacacaggggcggctttgaacttc
acactgaagctgttgcaaagagcaaagaaggaacgaggaagcaaagtgccgtgtcacctg
gtggttctgaccaatggcatgtctcgggacagcgtcctggggcctgcccataagctgaga
gaggaaaacatcagagtgcatgcgatcggtgtcaaggaagccaaccaaacgcagcttcgg
gagatagcgggagaggaaaagcgagtttactacgtccatgagttcgatgccttgaggaac
ataaggaaccaagtggttcaggagatctgtgctgaagaagcctgcagagacatgaaagcg
gacatcatgtttctggtggacagctctggcagcatcggacctgaaaacttcagcaagatg
aagatgtttatgaagaacctggtgagcaaatcccagatcggggctgaccgggtgcaaatt
ggcgtggtccagttcagccacgaaaacaaggaggagtttcagctcaacacgttcatgtct
caaagtgacatcgccaacgccattgaccgaatgactcacattggagaaacaaccttgacg
ggcagtgccctgacctttgtgtctcagtacttcagtcccgataagggggccaggcccaat
gtcaggaagttcctcattcttatcacggatggtgaggctcaggacatagtaagggaccca
gcgatcgcccttcgaaaagaaggtgtgattatctattctgtgggagtattcggctccaat
gtcacccagcttgaggagatcagtggaaagccagagatggttttctatgttgagaatttt
gacattctgcagcatatcgaagatgacctcgttctggggatctgcagtccccgtgaagaa
tgcaagcggattgaagttttggatgtggtgtttgtcatcgatagctccggcagcattgac
tatcaagaatataacatcatgaaggacttcatgattggcttggtgaaaaaagctgacgtg
ggcaagaatcaggtccggtttggagccctgaagtatgctgatgaccccgaagtgctgttt
tacctggatgaactaggcacgaagctggaggtagtttcagtgctccagaatgaccatccc
atgggtggaaatacttacaccgctgaggccctcgccttctccgatcacatgttcaccgaa
gcccggggcagccgtctgcacaagggagtcccccaagtcctcattgtgattaccgacggg
gaatctcatgacgcagagaagctcaacaccaccgccaaggccctgagagacaaaggcatt
ctcgtcctggctgtggggattgccggtgccaacagctgggagctcttggccatggcaggg
tcaagcgacaagtactactttgtagagaccttcggaggcctgaagggaatattttccgat
gtgtcagccagtgtctgtaactcttcaaaagttgattgtgaaattgaaaaggttgacctt
gtattcctcatggatggttcaaacagcatccatccggatgacttccagaagatgaagggg
tttttggtgtcggtcgttcaagacttcgatgtcagcctcaacagagtccgcataggcgtg
gcacagttcagcgacagctacaggtcagagtttctgctggggacgttcaccggggagagg
gagatatccacccagattgagggcatccagcagatctttggatacacccacatcggagat
gctctcaggaaggtgaagtattactttcagccagacatgggcagcaggatcaacgcaggt
accccccaggtgctgctggtcctcacagatggccggtcccaagacgaggtagctcaggcc
gccgaggagctgagacacaaaggtgtggacatctactcggtgggcatcggggatgtggat
gaccaggaattggtccagatcacggggaccgcggagaaaaaactgaccgtgcataacttc
gacgagctaaaaaaggtgaagaaaaggatcgttcggaacatctgtacctcaggtggtgag
agcaattgctttgtggatgtcgtggttggatttgacatctcaagcctgcagagagggcag
actctgctcgaaggtcagccttggatgggatcctacctccaagacctcttacgtgccatc
agctccctcaatggggtaagctgtgaagtgggcacagagactcaggtgagcatagctttt
caagtgacgaacgctatggaaagatacccttccaagtttgagatctacagtgagaacata
ctaagcagcctgcagggtgtgaccgtgaatggcccgtctcgcctcaacgccaacctgctg
agttctctgtgggatacgtttcagaataagtcagctgctcgtgggaaggtggtccttcta
ttttcagatggactggatgatggcattgagaaacttgaacagaagtctgatgaactcagg
aaggaaggcctgaatgccctcataaccattgctgtggatggagctgccgattccagtgac
ctggcggacctcctctacattgaatttgggaaaggatttgaatacaggacacagttcaca
attggaatgaggaaccttgggagtcagctgtcaaggcaactaatcaatgttgcagagagg
acctgctgctgtctgctctgcaagtgcacaggaggggacggcgccatgggggatccaggc
tcagcaggaaaaaagggacccccaggattcaaaggcagtgatggctacctcggagaggag
ggcattgctggagaaagaggagcctctgggccaatgggagagcaaggcacgaagggatgc
ttcggtgccaaagggcctaagggaaccagaggactcagtggagaagagggtgaagtcggg
gaagatgggcttgatggattagatggagaacagggtgaccatgggattcctggaagaaga
ggagaaaagggtgacgagggatctcagggaaacccaggcaggagaggggctgccggtgac
cgtggagcaaagggactgcgaggagatccgggaactcctggacgtgacagtagcatacaa
ggacccaagggcttgaaaggagaccttggaagacaaggcagaagaggctggccaggctct
cctggaacaccaggctcaagaagaaagatggtagttcatggccgaagaggacacataggc
ccacagggaaatccaggaaccccgggcccagatggacttgcaggttcgccaggacttaga
ggcccgcagggtccaagaggagaggtcggtgagaaaggagaaaaaggaagtctgggaatg
aaaggtcctcaggggcctccaggacccggaggacaagctgggagccaaggccatttggga
agccaaggaaacaaaggagaacctggagacctgggagaaaagggagctgctggctttcca
ggtcctcggggcctgcagggtgacgacggcagcccgggatatggtagcattggccgcaaa
gggacaaaggggcaagaaggattccccggagagagtggactgaagggtgatattggggac
cctggtgatccaggagaagctggtcccaagggagccagaggcaaaacggtatctgctggg
attccaggagagccggggtcccccggggagccaggaccccctggacggaagggtgtgaaa
ggggcccgaggactggcttcgttttccacatgtgacctcattcagtacgtgcgggaccac
agtcctggcagacatggaaaacctgagtgcccagtgcatccaactgagttggtgtttgtc
ctggaccagtcccgggatgtcacagagcaggactttgagcgaatgaaggggatgatggtc
tccctagttagggatgtcaaggttagggaggccaactgccccgtgggtgcccgcgttgcc
atcctagcctacaactcccacaccaggcacctcatccgcttctcagatgcctacaggaag
gaccagctgctcacggcgattaaagctcttccttatgagagatcctccgacagcagggag
attggcaaagccatgaggttcatctccaggaatgtcttcaagagaacccttccaggggct
catgtgagaagaatcgccacgttctttagcagtggtccatcggccgacgcccagaccatt
accacagccgccatggagttcagtgccctggacattgtacctgtggtgattgcgttcagc
aacgtgccctcggtcaagcgcgccttttcaattgatgacactggcacattccaagtcatt
gtggttccctccgggtctgatgaagggccagcgttagagagactccagcggtgcactttc
tgctatgatctatgcaagccggatgcttcgtgtgaccaagccaaaccaccccccattcag
tcctacctggacactgcattcctactggatggctctcggcacgtgggaagtgcagagttt
gaagacatgagagactttctagaggcactgctagatcacttcgaaatcacttcggagcca
gagacatctgtcactggagacagggtggccctgctgagccatgcccccctcgacttccta
cccaacacccagaggagtccggttagaactgagttcaacctaaccagctatagcagtaag
cgcctcatgaagagacacgtggatcaggcagtccagcagctgcatggagatgcttttctt
ggccatgccctcgggtgggcactggacaacgtctttttaaacacccccaatttgagacga
aacaaagtcatatttgtgatatctgctggggaaaccagccacctggatgcggaaacctta
aagaaagagtccctacgagccaaatgtcatgggtatgccctctttgtcttttccttgggc
cctgactgggatgacaaggaactggaagacctggccagccaccccgtagaccagcacttg
atccagcttggccgaattcataaacctgaccacggatacagtgtgaagtttgtgaagtct
tttataaactccatcaggcatgggataaacaagtatccaccggtcaacctcaaagccaag
tgcaacagactcggctctagggatctgaagccgcccccacgccagtttcgaagctttgtt
ccaggaccacagaaagccaacctcaaagaccacacagcagaggcagcaaagctctttcaa
gataaaaaacgcctttcaagtatgctgaaagggggcagagctactatttcaagtctttcc
agaagcacacgctatgcctttaaacaggggaaagaagcaataaaagccacttctaaactc
ggtaaacgaagtgcctga

KEGG   Mus musculus (mouse): 329278
Entry
329278            CDS       T01002                                 

Gene name
Tnn, TN-W, Tn, Tnw, tenas, tenascin-W
Definition
(RefSeq) tenascin N
  KO
K06252  tenascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    329278 (Tnn)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    329278 (Tnn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    329278 (Tnn)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    329278 (Tnn)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    329278 (Tnn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    329278 (Tnn)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   329278 (Tnn)
SSDB
Motif
Pfam: fn3 Fibrinogen_C DUF4998 Interfer-bind Pur_ac_phosph_N DUF4959 EGF_2 EGF_Tenascin Wtap Ax_dynein_light
Other DBs
NCBI-GeneID: 329278
NCBI-ProteinID: NP_808507
MGI: 2665790
Ensembl: ENSMUSG00000026725
Vega: OTTMUSG00000025412
UniProt: Q80Z71
Position
1; 1 H2.1
AA seq 1560 aa
MGLWGMLAFPLGFLLASVLLVASAPATPESPGCSNKEQQVTVSHTYKIDVPKSALVQVET
DPQSLSDDGTSLLAPGEDGEEQNIIFRHNIRLQTPQKNCDLADSVQDLLARMKKLEEEMA
ELKEQCNTNRCCQGAADLSRHCSGHGTFLPETCSCHCDQGWEGADCDQPTCPGACNGHGR
CVDGQCVCDAPYVGVDCAYAACPQDCSGHGVCVQGVCQCHEDFTAEDCSEQRCPGDCSGN
GFCDTGECYCEMGFTGPDCSQVVAPQGLQLLKSTENSLLVSWEPSSEVDYYLLSYYPLGK
EQATKQVRVPKEQHTYDITGLLPGTKYIVTLRNVKKDISSSPQHLLATTDLAVVGTAWVN
EETETSLDVEWENPLTEVDYYKLRYGPLTGQEVTEVTVPKSRDPKSRYDITGLQPGTEYK
ITVVPIRGDLEGKPILLNGRTEIDGPTNVVTNQVTEDTASVSWDPVRADIDKYVVRYIAP
DGETKEKAVPKDQSSTVLTGLKPGEAYKVFVWAERGNQGSKKADTKALTEIDSPENLVTD
RVTENSLSVSWDPVEADIDRYVVSYTSVDGETKQVPVKKDQRSTVLTGLSPGVEYKVYVW
AEKGDRESKKANTKAPTDIDSPKNLVTDQVTENTLSVSWDPVQANIDRYMVSYTSADGET
REVPVPKEKSSTVLTGLRPGVEYKVHVWAQKGTQESRKANTKAPTDIDGPKNLVTDQVTE
TTLSVSWDPVEADIDRYMVRYTSPDGETKEVPVSKDKSSTVLRGLRPGVEYKVDVWAQKG
AQDSRKANTKAPTDIDSPKNLVTEQVTESTATVSWDPVEADIDRYVVRYTSVDGETREFL
VGKDQTSTVLTGMRPGVEYQVDVWAQKGTQESRKTSTKAPTDIDGPKNLVTDQVTETTLS
VSWDPVEADIDRYMVRYTSPDGETKEVPVSKDKSSTVLRGLRPGVEYKVDVWAQKGAQDS
RKANTKAPTDIDSPKNLAIDQVTETTLSVSWDPVQADIDRYVVRYTSADGESKEFLIGKE
QRSTVLTGLRPGVEYKVEVWAQKGARESKKANTEGHTDIDSPKNLVTNQVTENTATISWD
PVQADIDRYMVRYTSADGETREIPVRKEKSSTVLTGLRPGVEYTVQVWAQKGARESKKAK
TKAPTEIDSPKNLVTNRVTENTATISWDPVRANIDRYMVRYTSADGETKEIPVSKDQSST
ILTGLKPGMEYTIHVWAQKGARESKKADTKALTEIDPPRNLRPFGVTHSGGVLTWLPPSA
QIDGYILTYQFPNGTVKEVELPRGQQRFELQDLEQGVTYPVSLVAFKGNQRSRTVSTTLS
TVDARFPHPSDCSQVQQNTNAASGLYTIYLNGDASRPMQVYCDMDTDGGGWIVFQRRNTG
QLDFFKRWRSYVEGFGDPMKEFWLGLDKLHNLTTGTTTRYEVRADLQTFNESAYAVYDFF
QVASSKERYKLSVGKYRGTAGDALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCH
LANPNGKYGETKHSEGVNWEPWKGHEFSIPYVELKIRPFGYSRDRFSGRKKRSIGKARMF
NT seq 4683 nt   +upstreamnt  +downstreamnt
atgggtctctgggggatgctcgccttccccctgggatttctgcttgcttctgtgctcctg
gtggcttcggccccagccactccagagtctcccggctgcagcaacaaagagcaacaggtc
actgttagccacacctacaagattgacgtgcccaagtctgctctggttcaagtagagacc
gacccacagtcactcagcgatgatgggacatcactcttggctcccggggaggatggggag
gagcagaacattatcttcaggcacaacatccgtcttcagacaccgcagaagaattgcgac
ctggcagacagtgtccaggacctgctagcccggatgaaaaagctggaggaagagatggca
gagctgaaggagcagtgcaataccaaccgctgctgccagggggctgctgatctgagccgt
cactgcagtggccacgggaccttcctccctgagacctgcagctgccactgtgaccagggc
tgggagggcgcagactgtgatcagcccacctgtcctggggcttgcaacggccacgggcgc
tgtgtggatgggcagtgcgtgtgtgacgcgccctatgtgggggtcgactgcgcctacgcc
gcctgtccccaggactgcagtgggcatggcgtgtgcgtgcagggtgtctgccagtgccac
gaggacttcacagcagaggactgcagcgagcagcgctgtcctggcgactgtagtggcaat
ggtttctgtgacactggcgagtgttactgtgagatgggctttactggccccgactgttcc
caggtggtggctcctcagggcctgcagttgctcaagagcacggagaactctctgctggtg
agttgggagccctccagtgaggtagactactacctgctcagctactaccccctggggaag
gagcaagctacaaaacaggtccgggtacccaaggagcagcacacctatgacatcaccggc
ttgctgcctggaaccaagtacatagtcaccctgcgcaacgtgaagaaagacatttccagc
agccctcagcatctacttgccaccacagatcttgctgtggtgggcacagcctgggtaaat
gaagagactgagacatccctcgatgtggagtgggagaaccctctgactgaggtggactat
tacaagcttcggtatggccccttaacagggcaggaggtgacagaggtcactgtgcccaag
agccgtgatcccaagagcagatatgacatcactggtctgcagcctggaacggaatataaa
atcacagttgtgcccatccgaggtgatctggagggaaagccgattctcctgaatggcagg
acagaaattgatggaccaaccaatgtggtcacaaatcaggtgacagaagacacagcatct
gtttcctgggatccagtgagggctgacatagacaagtatgtggtgcgctatatcgccccc
gatggggagaccaaggagaaggcagtaccaaaggaccagagcagcaccgttctcacaggc
ctgaagccaggagaggcctacaaagtctttgtgtgggctgagaggggcaaccaaggcagc
aagaaagcagacaccaaggccctcacagaaattgacagtccagaaaacctggtgactgac
cgggtgacagagaacagcctctctgtctcgtgggacccagtggaggctgacatcgacagg
tatgtggtaagctacacttccgtggatggagagacgaagcaggttccagtgaagaaggac
cagaggagcaccgtcctcaccggcctgagtcccggtgtggagtacaaagtttacgtgtgg
gcagagaaaggcgatcgggagagcaagaaggccaacaccaaggctcccacagacatcgac
agccccaaaaacttggtaactgaccaggtgacagagaacactctcagtgtctcctgggac
cctgttcaggccaacattgacaggtatatggtgagctacacctctgccgatggagagaca
agagaggtcccagtgcctaaggagaagagcagtaccgtcctgactggcctgaggccaggt
gtggagtacaaggtccatgtgtgggcccagaaggggacccaggagagcagaaaggccaac
accaaggcccccacagatattgatggccccaaaaacctggtgactgaccaggtgaccgag
accactcttagtgtctcctgggacccagtggaggctgacattgataggtacatggttcgc
tacacgtctcctgatggagagaccaaggaggtgcctgtgtcaaaggataagagcagcaca
gtcctgaggggcctgaggccaggtgtggagtacaaggtggatgtatgggcccagaagggg
gcccaggacagccggaaggccaacaccaaggcccccacagatattgacagccctaaaaac
ctggtgactgagcaggtgacagagagcactgccaccgtgtcctgggacccagtagaggct
gacatcgacaggtatgtggtgcgctacacttctgtcgatggcgagaccagggaatttctc
gttgggaaggaccaaacaagcaccgtcctgacaggcatgagaccaggtgtggagtatcag
gtcgacgtgtgggcccagaaggggacacaggaaagcaggaagaccagcaccaaagcccca
acagatattgatggccccaaaaacctggtgactgaccaggtgaccgagaccactcttagt
gtctcctgggacccagtggaggctgacattgataggtacatggttcgctacacgtctcct
gatggagagaccaaggaggtgcctgtgtcaaaggataagagcagcacagtcctgaggggc
ctgaggccaggtgtggagtacaaggtggatgtatgggcccagaagggggcccaggacagc
cggaaggccaacaccaaggcccccacagatattgatagtcccaaaaacctggcgatcgac
caggtgacagagaccactctcagtgtctcctgggacccagtacaggctgacattgacagg
tatgtggtgcgctacacctctgctgatggggaatccaaagaattcctgattgggaaggaa
cagaggagcacagtcctgacaggcctgaggccaggtgtggagtacaaggttgaagtgtgg
gcccagaaaggagcccgggagagcaagaaagccaacaccgaaggtcacacagacattgac
agccccaaaaacctggtgaccaatcaggtgaccgaaaatacagccaccatctcctgggac
ccggtgcaggctgatattgacagatacatggtgcgctacacatctgctgatggagagacc
agggagattccagtgaggaaggagaagagcagcactgtcctcacaggcctgagaccgggt
gtggagtacacggtccaagtgtgggctcagaagggggcccgggagagcaagaaggccaaa
accaaggcccccacagaaattgacagccccaagaacttggtgaccaaccgagtgacagaa
aatacagccaccatctcctgggacccagtgcgagccaacattgacaggtacatggttcgc
tacacctctgcggatggagagactaaggagattccagtgtcaaaggatcagagtagcacc
atcctgacaggcctgaaaccaggcatggaatataccattcatgtgtgggcccagaagggg
gcccgggagagcaagaaggctgataccaaggccctaacagaaattgaccctcccagaaat
ctccgtccgttcggggtaacacattctggtggggttttgacctggttgcccccatctgct
caaattgatggctacattttgacctaccagttcccaaatggcaccgtgaaggaggtggag
ctcccaagaggccagcagagatttgaattgcaagacctggaacagggtgtcacctatcct
gtttccttggttgccttcaaaggtaatcagcggagccggactgtgtctaccaccctttct
acagtggatgctcgctttccacacccctcagactgcagtcaagttcagcagaacaccaac
gctgccagtgggctctacaccatctacctcaatggtgatgccagccggcccatgcaggtg
tactgcgacatggacactgacggaggcggctggattgtcttccagagacggaacactggg
cagctggatttcttcaagcgttggcggagttatgtagaaggttttggggaccccatgaag
gagttctggcttggacttgataaactacataatctcaccactggcaccaccactcggtat
gaggtgagggcagacttacagactttcaatgaatctgcctacgctgtatatgatttcttc
caagtggcatccagcaaagagcggtacaagctgtcggttgggaaatacagaggcacagcc
ggggatgctctcacctaccacaatggatggaagttcacgacttttgacagagacaatgat
attgccctcagcaactgtgcactgacgcatcatggtggctggtggtataagaactgccat
ttggccaacccgaatggcaaatatggggagaccaagcacagcgagggggtgaactgggag
ccatggaagggacatgagttctccattccttatgtggagctgaaaatccgcccgtttggt
tacagcagagaccgtttctctggcagaaagaagcgctccataggaaaagcaaggatgttc
tga

KEGG   Mus musculus (mouse): 665033
Entry
665033            CDS       T01002                                 

Gene name
Col6a5, Col, Col29a1, EG665033, Gm7455
Definition
(RefSeq) collagen, type VI, alpha 5
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    665033 (Col6a5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    665033 (Col6a5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    665033 (Col6a5)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    665033 (Col6a5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    665033 (Col6a5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    665033 (Col6a5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    665033 (Col6a5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   665033 (Col6a5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   665033 (Col6a5)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   665033 (Col6a5)
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 Radical_SAM VWA_CoxE Copine
Other DBs
NCBI-GeneID: 665033
NCBI-ProteinID: NP_001161395
MGI: 3648134
Ensembl: ENSMUSG00000091345
Vega: OTTMUSG00000049419
UniProt: A6H584 A0A140T8W1
Position
9 F1; 9
AA seq 2640 aa
MKLRLIAFVLILWTETLADQSPGPGPEYADVVFLVDSSNYLGIKSFPFVRTFLNRMISSL
PIEANKYRVALAQYSDALHNEFQLGTFKNRNPMLNHLKKNFGFIGGSLKIGNALQEAHRT
YFSAPTNGRDKKQFPPILVVLASAESEDDVEEAAKALREDGVKIISVGVQKASEENLKAM
ATSQFHFNLRTARDLGMFAPNMTRIIKDVTQYREGTTVDLITAVAPTTPAAPATPAAPTI
PAALTTAANHVDKTVPFPTSCQKDSLADLIFLVDESVGTTQNLRDLQNFLENVTSSVDVK
DNCMRLGLMSFSDRAQTISSLRSSANQSEFQQQIQKLSLQTGASNVGAAIEQMRKEGFSE
SSGSRKAQGVPQIAVLVTHRASDDMVREAALDLRLEGVTMFAMGIEGANNTQLEDIVSYP
SRQSISTHSSYSHLESYSGNFLKKIRNEIWTQVSTRAEQMELDKTGCVDTKEADIYFLID
GSSSIRKKEFEQIQIFMSSVIDMFPIGPNKVRVGVVQYSHKNEVEFPVSRYTDGIDLKKA
VFNIKQLKGLTFTGKALDFILPLIKKGKTERTDRAPCYLIVLTDGKSNDSVLEPANRLRA
EQITIHAIGIGEANKTQLRQIAGKDERVNFGQNFDSLKSIKNEIVHRICSEKGCEDMKAD
IMFLVDSSGSIGPTNFETMKTFMKNLVGKIQIGADRSQVGVVQFSDYNREEFQLNKYSTH
EEIYAAIDRMSPINRNTLTGGALTFVNEYFDLSKGGRPQVRKFLILLTDGKAQDEVGGPA
TALRSKSVTIFSVGVYGANRAQLEEISGDGSLVFHVENFDHLKAIESKLIFRVCALHDCK
RIELLDIVFVLDHSGSIGPREQESMMNLTIHLVKKADVGRDRVQIGALTYSNHPEILFYL
NTYSSGSAIAEHLRRPRDTGGETYTAKALQHSNVLFTEEHGSRLTQNVRQLMIVITDGVS
HDRDKLDEAARELRDKGITIFAVGVGNANQDELETMAGKKENTVHVDNFDKLRDIYLPLQ
ETLCNNSQETCNLPEADVIFLCDGSDMVSDSEFVTMTTFLSDLIDNFDIESQRMKIGMAQ
YGSRYQEIIELESSLNKTQWKSQVHSVAQSKGLPRLDFALKHVSDMFDPSVGGRRNAGVP
QTLVVITSSSPRYDVTDAVKVLKDLGICVLALGIGDVYKEQLLPITGNSEKIITFRDFNK
LKNVDVKKRMVREICQSCGKANCFVDVVVGFDISTHRQGQPLFQGHPRLESYLPGILEDI
TSIRGVSCGAGAEAQVSLAFKVNSDQEFPAKFQIYQKAAFDSLLHVTVRGPTHLDAPFLQ
SLWDMFEERSASRGQVLLIFSDGLQGESITLLERQSDRLREAGLDALLVVSLNTFGHDEF
SSFEFGKGFDYRTQLTIGMLDLGKTLSQYLGNIAERACCCTFCKCPGIPGPHGTRGLQAS
KGSSGPKGSRGHRGEDGDPGRRGEIGLQGDRGVVGCPGTRGQKGVKGFSGAQGEHGEDGL
DGLDGEEGFYGFRGGKGQKGDPGNQGYPGIRGAAGEDGEKGFPGDPGDPGKDSNIKGQKG
EKGERGRQGITGQKGTHGRPSSKGSRGMEGQRGPQGPSGQAGNPGPQGTQGPEGLQGSQG
SSGNRGGKGDKGSQGYQGPQGSPGPAGPRGDIGRPGFGGRKGEPGVPGGPGPVGPPGQRG
KQGDYGIPGYGQTGRKGVKGPTGFPGDPGQKGDAGNPGIPGGPGPKGFKGLTLSQGLKGR
SGLQGSQGPPGRRGPKGTAGQPIYSPCELIQFLRDHSPCWKDKCPVYPTELVFALDQSSG
ITERRFNETRDTITSIVSDLNIRENNCPVGARVAVVSYDSDTSYLIRGSDYHNKKHLLQL
LSQIKYQVPRKARDIGNAMRFVARNVFKRMSAGTNTRRVAVFFSNGQAASRASILTATME
LSALDISLAVFAYNERVFLDEAFGFDDTGTFQVIPVPPVGDYEPLEKLRRCTLCYDKCFP
NTCAEEPFFPENSYMDVAFLLDNSKNIASDDFQAVKALVSSVIDSFHITSNPSASESGDR
VALLSYSPSESSRRKGRVKTEFAFTTYDNQSIMKNYIYTSLQQLNGDATIGLALQWAMEG
LFLGTPNPRKHKVIIVISAGENHEEKEFVKTVALRAKCQGYVVFVISLGSTQRDEMEELA
SYPLDHHLIQLGRMYKPDLNYIVKFLKPFIYSVRRGFNQYPPPTLKDDCRLVELERGDTL
PHGLRLTAKLREVPESTISLADQELNAGKDSSFVLEDHRGDHLVYVPSQMLEPHKLVSHY
GNDRESVAMASLTSEHESHGREELGLAHEPGDASLQEYYMDVAFLIDASQRVGGRNEFKE
VRTLITSVLDYFHIAPAPLTSVLGDRVAVLTYSPPGYLPNTEECPVYLEFDLVTYNTVHQ
MKHHLQESLQQLNGDVFIGHALQWTVDNVFVGTPNLRKNKVIFIVTAGETNPLDKEVLRN
ASLRAKCQGYSIFVFSFGPIHNDMELEELASHPLDHHLVRLGRVHRPDLDYVIKFIKPFV
HSIRRAINKYPGRDLQAKCDNLTFPGPENAGTEDSALLIPEVYRIEAGENELSGDSGSQE
QHFFLLGNSHGNHSESTADLMRQLYLLLSSGELMVNDKEEPCSAETPAPVNSKQDGEDAR
NT seq 7923 nt   +upstreamnt  +downstreamnt
atgaagctccggctaattgcgtttgtcttaatcctctggactgaaaccctggcagaccag
agcccagggccaggccccgagtacgcagacgtggtgtttctggtggacagctccaattac
ctgggaattaagtccttcccatttgtgagaacttttctcaacaggatgatcagcagcctc
cccatagaggccaacaagtaccgcgtggccctggcccagtacagcgatgctctccacaat
gagttccagctgggcaccttcaagaacaggaaccccatgctgaaccacctgaagaagaac
ttcgggttcatcggtggctccctgaagatagggaacgccctgcaggaggctcacaggacc
tatttctctgctcccacaaatgggagagacaagaaacagttccccccaatcctggtggtg
ctggcttcagcagagtctgaggatgatgtggaagaggctgcgaaggccctgcgggaagat
ggggtgaaaatcatctctgtgggggtgcagaaggcttctgaggaaaacctgaaggcgatg
gccacctctcagttccatttcaatctcaggactgccagagacctcggcatgtttgcccca
aacatgacacggatcatcaaggatgtgactcagtacagggaagggacaactgtggactta
atcacagctgtagccccaaccacacctgcagccccagccacacctgcagccccaaccata
cctgcagctctaaccacagctgccaaccacgttgataagacagttccctttcccacctct
tgccagaaggactcccttgccgaccttatattcttggtggatgagtcagtggggaccaca
cagaatctgagggacctgcagaacttcctggagaatgtcaccagctctgtggatgtgaag
gacaactgcatgcggcttgggctgatgagcttcagcgacagggctcagactatttcttcc
ctgaggtcaagcgccaaccagtctgaattccagcagcaaatccagaaactctctctccag
actggggcatctaatgttggggccgccattgagcagatgaggaaagaaggcttctcagag
tccagtggcagcaggaaggcccagggcgtcccccagattgctgtgctggtcacccacaga
gcatcagatgacatggtgcgggaggctgcactggatctgcgcttggagggtgtaactatg
tttgcaatgggcatcgaaggggccaacaacacgcaattagaagacatagtgtcataccct
tccaggcagagcatttccacacacagctcctacagtcacttggaatcatacagtgggaac
ttcctgaagaagatccgcaatgaaatctggacccaagtttctactcgtgctgaacaaatg
gagctggataaaaccggctgtgtggatacaaaggaggccgacatctattttctcattgat
gggtcgtccagcatccgtaagaaagagtttgagcaaatccagatatttatgtcatctgtg
atagacatgtttcctatcggccccaacaaagttcgggtcggagttgtgcagtattcacat
aagaatgaagtggaatttcctgtctctcgctacacggatggcattgacttgaaaaaggct
gtttttaacatcaagcaactcaaaggtcttacattcaccgggaaagccctggatttcata
ttgcctctcataaagaagggaaaaacagagaggaccgacagagccccctgttacctcatc
gtgctgactgatggaaagtcaaatgacagcgttctcgaacctgccaacagactgcgggct
gagcagatcaccattcacgccatcgggattggcgaggcaaacaaaacacagctgcggcag
attgctgggaaggacgaaagggttaacttcgggcagaacttcgattctctgaagagcata
aaaaatgaaatcgttcaccgcatctgctctgaaaaaggatgtgaagacatgaaggcagac
atcatgtttttggtggacagttctggaagcatagggcctacaaattttgagacaatgaaa
actttcatgaaaaatctggtggggaagattcagattggcgccgacagatcccaagtcggt
gttgttcaattcagtgactataacagggaagaattccagcttaataaatactccacgcat
gaggaaatttatgcagccatagataggatgtctcccatcaacagaaacactctgacagga
ggagcactaacctttgtaaatgaatactttgacctttccaagggggggcgcccccaggtc
agaaagttccttatcctcctcacagatggaaaagctcaggacgaagtggggggcccagcc
acggctctcaggagcaaaagtgtgaccatcttctccgtgggtgtgtatggggccaatagg
gctcagctggaggagatcagtggagatggcagtctggttttccatgttgagaactttgac
catctgaaggccatagagagtaaactcatctttcgagtgtgtgctctgcatgattgcaag
aggatcgaactcttagacatcgtgtttgtgctggaccactcaggcagcataggtccacgt
gagcaagaaagcatgatgaacctcaccatccacttggtgaagaaggcagacgttggtagg
gaccgagtgcagattggagcgctcacatactccaaccatcccgagatcctcttctatctt
aacacttactcaagtggatcagccattgctgagcatctgaggaggcccagggacaccgga
ggggagacctacactgccaaggctcttcagcattccaacgtcctgttcacagaagagcat
ggcagccgcctgacgcagaacgtgaggcagctgatgattgtcatcacggatggcgtgtcc
cacgaccgagataaactcgacgaggcagcacgggaactcagagacaaaggcatcaccatc
tttgcagtgggtgtaggaaatgccaaccaagatgaactggagaccatggcagggaagaaa
gaaaacactgtccatgtagacaactttgacaaactgagagatatttacctgcctctgcaa
gagactctgtgtaataattcacaagagacttgtaaccttccggaagctgatgtgattttc
ctttgtgatggctctgacatggtgtctgattcagagttcgttaccatgacaactttcttg
tcagacttaattgataattttgacattgagtctcaaagaatgaagattgggatggctcaa
tacgggagccggtatcaggaaattattgagttggaaagctctctgaacaagactcagtgg
aagtctcaggtccacagtgtggcccagagcaaggggttgccacgccttgactttgctctc
aagcatgtgagtgacatgtttgatccatccgttggcgggagaaggaacgctggtgtccct
cagactctggttgttataacatctagttctccacgctatgatgtgacagacgcggtaaag
gtcctgaaagaccttggcatctgtgtcctggctttgggcataggggatgtttataaggaa
cagcttctgcccatcacaggcaattcagaaaagataattactttccgagactttaataag
ctaaagaatgtggatgtgaagaagagaatggttcgtgaaatttgccagagctgtgggaaa
gccaattgctttgtggatgtagtggtcgggttcgacatttccactcaccgtcagggccag
cctttgttccagggccatccccgcttagaatcctacctcccgggcatcttggaggacatc
acctctatcagaggggtgagctgtggtgcaggtgcagaggcgcaggtgagcctggccttt
aaggtgaacagtgaccaagagttcccagccaagttccagatctatcagaaagcagcgttt
gacagcttgttgcacgtcacagtccgtggaccaactcatctggatgcaccgttcttgcag
tcactttgggacatgtttgaggaaagatctgcatccaggggccaggttctgctcatcttc
tcagacggtctccagggtgaaagcatcaccttgctggagcggcagtcagacaggctcaga
gaagcaggacttgatgctctgttggtggtgtcccttaacacattcggtcacgatgagttt
tccagctttgaatttggaaaaggatttgactacaggactcagctgaccattgggatgcta
gacctgggcaagacgctctcacagtacctgggaaacatcgcagaaagggcttgctgctgt
acattttgtaaatgtccggggattccaggacctcatggaacccggggactccaagcctca
aagggttcttcaggtccaaaaggtagcagaggacacaggggagaggacggagaccctgga
agacgaggagaaattgggcttcaaggagacagaggagtcgtgggatgcccggggactcga
ggtcaaaagggagtcaaaggattttcaggagctcagggggaacatggagaggacgggctg
gacggactggatggagaagaaggattttacggatttcgtgggggaaagggacaaaaaggt
gaccctggcaatcagggttacccaggcatcagaggcgctgctggggaagatggcgagaag
ggcttcccaggggatcccggtgacccaggaaaagacagcaacatcaaaggccagaagggc
gagaaaggagaacgaggaagacaagggataactgggcagaaggggacacatggccgtcct
agctccaaaggaagcaggggaatggagggccagagggggccccagggtccctcagggcag
gcaggaaacccaggacctcaaggtacacaaggacctgaaggactacaaggctcacaggga
tcaagtggaaatcgtggagggaaaggagacaaaggaagtcaaggttatcagggacctcag
ggttctcctgggccagcaggacccagaggggatattggaagacctggatttggggggaga
aagggggaacctggagttcctggaggcccaggaccagtggggccccctggacagcgagga
aagcagggagattatggcatcccgggctatggtcagacaggaagaaaaggagttaagggc
ccaacaggattccctggggacccagggcagaagggtgacgctggcaatcctggaattcct
gggggacctggacccaaaggattcaagggactgactctctctcaaggcttgaaaggcagg
agtggacttcaggggtctcaaggccctcctggtcggagaggtcctaaaggcacagcaggg
caacctatatattccccctgtgaactgatccagttcctgagggaccacagcccctgttgg
aaagacaagtgccctgtgtatccaacagagctggtctttgctctggaccagtcctctggt
atcacagaaaggagatttaatgaaacaagggacaccatcacttcaattgtcagtgacctc
aacatcagggagaacaactgtcccgtgggagcacgggttgccgtggtctcctatgactca
gacaccagctatctcatccgtggctctgactaccataacaagaagcatctcctacagctt
ctttcccagataaaataccaagtgccccggaaggccagggacattggcaatgcaatgagg
tttgtggcccgcaacgttttcaagcggatgtctgcgggaaccaacaccaggagagtggct
gtgtttttcagcaatggccaggcagccagtagagcatccatcctcacggccaccatggag
ttgagtgccctcgatatcagccttgccgtctttgcttataacgaaagagtgttccttgat
gaggcttttgggtttgatgacactgggacatttcaggtgattccagtccccccagttgga
gattatgagccactggagaagcttcggcgctgcacactttgctatgacaagtgttttcca
aacacctgtgcagaagagcctttctttcctgagaattcctacatggatgttgcattcctc
ttagacaattccaaaaacatcgccagcgatgacttccaagccgtgaaagcgctggtgagc
tcagtgattgacagcttccacatcacttcaaacccttcagcctcagagtctggtgacagg
gttgctttgctgagctattctccctcagagagctccagaaggaagggcagggtgaagaca
gagtttgcctttacaacctacgacaaccaatcaatcatgaagaactacatctacacttcc
cttcaacagctcaatggagatgctactattggccttgccctacagtgggccatggaaggt
ctcttcctgggaacccccaatccaagaaaacacaaggtcatcattgtgatttcagctgga
gaaaaccatgaggagaaggaatttgtgaagacggtggctttgagggccaaatgtcaaggc
tatgtcgtatttgtgatatctctgggctccacacaaagagatgagatggaagaattagcc
agctacccactcgatcaccatctgatacagcttgggagaatgtacaagccagatctgaat
tatattgtgaaatttctgaagccctttatatactcggtcagacgcggatttaatcaatac
ccaccacccacgctgaaggacgactgcagacttgttgagttagagaggggagacacactg
ccccatggcctcagattgactgctaagctgcgtgaggttcctgagagcacaatcagcctg
gctgatcaagagctgaacgctgggaaagactcatcttttgtgttggaggatcacagaggc
gaccatttggtttacgttccaagccagatgctagagccacataagttagtgagccactat
ggaaatgaccgggaatctgtagcaatggcgagtctcacttctgaacatgaaagtcatggc
agagaagaactgggtcttgctcatgagcctggggatgcttctcttcaagaatattacatg
gacgtggctttcctcatagatgcttctcaacgagtaggaggacgtaacgagtttaaggaa
gtgagaactttgataacgtcagtactggattactttcacattgccccagctccactgacc
tctgtcttaggagacagagtggctgtcctgacctactctcccccaggctatctgccaaac
actgaagagtgcccagtctacctggaattcgatttggtcacttacaacactgtacatcaa
atgaagcatcatctccaagagtctcttcagcagctcaatggtgatgtttttattgggcat
gcccttcagtggacagttgacaatgtctttgtaggaacccccaatctgaggaaaaacaaa
gttatctttatagtaactgcaggtgaaaccaaccctttagacaaagaagttttaaggaat
gcatctctgagagccaagtgccaaggctactccatatttgtattttcctttggtccgata
cacaatgacatggagttagaagaattagcaagccaccctctggatcatcacttagtccgg
cttggccgggtacacaggccagatttggactatgtcatcaagttcatcaagccatttgtt
cattcgatcagacgtgctatcaacaaatatcccggcagagacctgcaagccaagtgtgat
aatctcaccttccctggcccagagaatgctggcacagaagacagtgcattactcatcccc
gaggtgtacagaatcgaggcaggagagaatgagctgtctggagactctggatctcaggag
cagcatttcttcctcctagggaacagtcatggcaaccattcagaaagcactgctgatctg
atgcggcagttgtacctgctcctctcctccggggaactgatggtgaatgataaggaagag
ccttgttccgcagagaccccagctccagtgaacagcaaacaagatggcgaagatgcaaga
tga

KEGG   Mus musculus (mouse): 68553
Entry
68553             CDS       T01002                                 

Gene name
Col6a4, 1110001D15Rik, AI413310, AU023415, Dv, Dvwa, EG235580, Vw, Vwa6
Definition
(RefSeq) collagen, type VI, alpha 4
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    68553 (Col6a4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    68553 (Col6a4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    68553 (Col6a4)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    68553 (Col6a4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    68553 (Col6a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    68553 (Col6a4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    68553 (Col6a4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   68553 (Col6a4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   68553 (Col6a4)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   68553 (Col6a4)
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 VWA_CoxE
Other DBs
NCBI-GeneID: 68553
NCBI-ProteinID: NP_081039
MGI: 1915803
Ensembl: ENSMUSG00000032572
Vega: OTTMUSG00000032575
UniProt: A2AX52 Q9CTL0
Position
9; 9 F1
AA seq 2309 aa
MGTWKTFWLIISLAAGLGFVKSQRIVCREASVGDIVFLVHNSINPQHAHSVRNFLYILAN
SLQVGRDNIRVGLAQYSDTPTSEFLLSVYHRKGDVLKHIRGLQFKPGGNRMGQALQFILE
HHFREGAGSRASQGVPQVAVVVSSGLTEDHIREPAEALRRAGILVYAIGVKDASQAELRE
ISSSPKDNFTFFVPNFPGLPGLAQKLRPELCSTLGKAAQYTERESPACSEASPADIVFLV
DSSTSIGLQNFQKVKHFLHSVVSGLDVRSDQVQVGLVQYSDNIYPAFPLKQSSLKSAVLD
RIRNLPYSMGGTSTGSALEFIRANSLTEMSGSRAKDGVPQIVVLVTDGESSDEVQDVADQ
LKRDGVFVFVVGINIQDVQELQKIANEPFEEFLFTTENFSILQALSGTLLQALCSTVERQ
MKKSTKTYADVVFLIDTSQGTSQASFQWMQNFISRIIGILEVGQDKYQIGLAQYSDQGHT
EFLFNTHKTRNEMVAHIHELLVFQGGSRKTGQGLRFLHRTFFQEAAGSRLLQGVPQYVVV
ITSGKSEDEVGEVAQILRKRGVDIVSVGLQDFDRAELEGIGPVVLVSDLQGEDRIRQLML
DVNMFIQGSPKPPRVMTDVAKDAVEECLVPVPADLVFLVEDFSSARQPNFQRVVHFLTTT
VHSLNIHPDTTRVSLVFYSEKPRLEFSLDMYQSAAQVLRHLDRLTFRARRGRAKAGAALD
FLRKEVFLPEKGSRPHRGVQQIAVVIIESPSLDNVSTPASYLRRAGVTIYAAGTQPASES
KDLEKIVTYPPWKHAIRLESFLQLSVVGNKLKKKLCPEMLSGMPPLMSFIPESTRQSTQE
GCESVEKADIYFLIDGSGSIKPNDFIEMKDFMKEVIKMFHIGPDRVRFGVVQYSDKIISQ
FFLTQYASMAGLSAAIDNIQQVGGGTTTGKALSKMVPVFQNTARIDVARYLIVITDGQST
DPVAEAAQGLRDIGVNIYAIGVRDANTTELEEIASKKMFFIYEFDSLKSIHQEVIRDICS
SENCKSQKADIIFLIDGSESIAPKDFEKMKDFMERMVNQSNIGADEIQIGLLQFSSNPQE
EFRLNRYSSKVDMCRAILSVQQMSDGTHTGKALNFTLPFFDSSRGGRPRVHQYLIVITDG
VSQDNVAPPAKALRDRNIIIFAIGVGNVQRAQLLEITNDQDKVFQEENFESLQSLEKEIL
SEVCSSQGCNIDLSVGVDTSTSSERAQQELRRLLPELMQQLAFLSNISCEAPGQMEPRFR
YVVPGSSDQPVFDSGFEKYSDETIQKFLVHQGSVNNRMDVDFLQSLGETAIHLSLAKVKV
LLVFTDGLDEDLERLRRTSEFLRSRGLSGLLLIGLGGAHKLEELQELEFGRGFAYRQPLS
SSLPSLPSVLLKQLDTIVERTCCNMYAKCYGDDGIRGEPGSRGEQGERGLDGLPGHPGEE
GDHGQRGPRGLPGLRGEEGCPGVRGPKGARGFSGEKGNPGEEGVGGLDGEQGDRGAAGPS
GEKGSSGSRGLTGLPGPAGPRGEPGLRGDPGDPGIDNLIQGPKGEKGRRGHQGSPGFHGP
LGEAGSVGPRGSLGRHGLPGLKGVLGETGELGSRGEPGHPGPQGPRGRQGPPGFFGQKGD
PGTQGNPGLPGPSGSKGPDGPRGLKGEVGPAGERGPRGQQGPRGQPGLFGPDGHGYPGRK
GRKGEPGFPGYPGVQGEDGNPGRGGEKGAKGIRGKRGNSGFPGLAGTPGDQGPPGKMGTK
GSKGLADRTPCEIVDFVRGNCPCSTGISRCPAFPTEVVFTLDMSNDVAPSDFERMRNILL
SLLMKLEMCESNCPTGARVAIVSYNTRTDYLVRLSDHRGKAALLQAVRKIPLERSSGSRN
LGATMRFVARHVFKRVRSGLLVRKVAVFFQAGRNYDTASVSTATLELHAADIATAVVTFT
EEHNLPEAGLVDGPNEFHLFTWETEGQQDVERLASCTLCYDKCRPALGCQLRAPGPQKLD
MDLVFLVDSSQGVSRDIYLGALRLVDSVLKDLEVAAQPGTSWHGARAALLTHTTPGFWPG
VDQAPVLEYFHLTSHGHRTEMQRQIREAASGLLQGGPALGHALEWTLENVLLTAVLPRRS
RVLYAIVASETSIWDREKLRTLSQEAKCKGIALFVLAVGPGVGAQELAELAKVASAPWEQ
HLLRLEGVSEAEVAYASRFTEAFLNLLNSGINQYPPPELVKECGGPNRGDTLLHFFTSAK
RFSRSQSGTSAAFANDSEALKSQGIFLGERKSRVASVALQEALGSHGKDRADTEDIDQET
PAKGRHLGPTHGPCPMGPEEGECLNYVLK
NT seq 6930 nt   +upstreamnt  +downstreamnt
atgggaacttggaagacattttggttgatcatctcccttgcagctggtttgggcttcgtc
aagtcacagaggattgtctgcagggaggcgtctgtgggagacattgtgtttctggtccac
aacagcatcaatccccagcatgcccacagtgtgcggaacttcttgtacatattggcaaac
agtttgcaagttggcagagacaacatccgtgtgggtctggcccagtacagcgatacaccc
acttctgagttcctgctttcagtttatcaccgcaaaggcgatgtgttgaaacacatccgt
ggacttcagtttaagcctggaggcaacaggatgggccaggccctgcagttcatcttagag
catcacttccgggaaggagccgggagccgggcaagccaaggggtgcctcaggtggccgtg
gtggtgagcagcggtctaacagaggaccacattcgcgaacctgcggaggctctcaggaga
gcgggaatcttggtatacgctattggggtcaaagacgcatctcaggctgaactcagggag
atttcgagtagtcccaaggataacttcaccttttttgttcccaacttccctggcttgcct
ggccttgcccagaagctgcggccagagctctgcagtactctagggaaggcagctcaatat
actgagcgggagtctccagcgtgctcagaagcatccccggctgacattgtgtttttggtg
gacagttcaactagcatcggactccagaacttccagaaagtgaagcatttcctccactct
gttgtctcggggctcgacgtcagaagcgatcaggtgcaagtggggctggtccagtacagt
gacaacatttacccagcctttccgctgaagcagtcctctctgaagagcgccgtcctggat
cggatccggaatctgccctacagcatggggggcacaagtaccggaagcgccctggagttc
atcagggccaactccttgactgagatgagtggcagccgtgccaaggatggggttcctcag
atagttgtcctggtgacagatggggagtccagtgatgaggtccaggatgtggctgaccag
ctgaaaagagacggggtctttgtgtttgtggtagggatcaatattcaagatgtccaagag
ttgcagaaaatagccaacgagccgtttgaggagtttctcttcaccacagaaaacttcagc
atcttgcaggcgctctcaggaaccctccttcaggccctgtgttccacggtggagaggcag
atgaaaaagtctaccaagacctacgcagacgtggtctttcttattgacacctcccagggg
acatcacaggctagtttccagtggatgcagaatttcatctctagaattattggcatcctg
gaggtcggccaggacaaataccagattgggctggctcagtatagcgatcaaggtcacact
gagtttttgttcaatacccacaagacccggaatgagatggtcgcacacatccatgaactc
ttggtgttccaaggtggctccaggaagactggccaaggccttcggtttcttcatcggact
ttcttccaggaggcagcaggaagccggctcttacagggtgtccctcagtatgtggtagtc
attacttcagggaaatctgaggacgaggtcggagaggtcgcacagatcctgaggaagaga
ggcgtggacatcgtgtctgtgggcttgcaggactttgacagggcagaactggaggggata
gggcctgtagtgcttgtgtctgacctgcagggagaagatagaatcagacagctaatgctg
gatgtgaatatgttcatccaggggagtccaaagcctccacgggtcatgactgatgttgcg
aaggacgctgtagaagaatgtctagttcccgttccagccgacctggtgttccttgttgag
gactttagcagtgccaggcaacccaatttccagcgagttgtccatttcttgacgaccact
gtccactctctcaacatccatcctgataccacaagagtcagcttggtcttttacagtgag
aaaccaaggctggagttttccctggatatgtatcaaagcgctgcccaagtcttacgccat
ctggacaggttaactttccgagcaagaagaggaagggcgaaggcaggtgctgctttagac
ttcctgaggaaagaagttttccttccagagaagggcagccggccccatcggggcgtacag
cagatagctgtggtcatcatagaaagtccttctctagacaatgtgtctacacctgcttcc
taccttcgcagggcgggggtcaccatctatgcagcgggcacccagcctgcctctgagagt
aaggacctggagaagattgtcacataccctccctggaagcacgccatccgcctagagtcc
tttctgcaactcagtgttgtaggaaacaaacttaaaaagaagctctgccctgagatgttg
agcggaatgcctcctctgatgagctttattccagaaagcacacgacaaagcacacaggaa
ggctgcgagagtgtggagaaggcagacatttacttccttattgatggatctggcagcatc
aaacccaacgacttcattgaaatgaaggacttcatgaaggaggtgataaagatgttccac
attgggcccgacagagtacgatttggagtcgttcagtactcagacaaaattataagccag
tttttcctcacccagtatgccagcatggcaggactgagcgcagccattgacaacatccaa
caggtgggaggtggtaccaccactggcaaggccttaagcaaaatggtaccagtcttccaa
aacactgccagaatcgacgttgcccgatacctcattgtcatcactgatggtcagtctacc
gacccggtggctgaggctgcgcagggattgagggacatcggagtcaatatttatgccatt
ggagtaagggatgctaatacgactgagcttgaggaaatagcaagcaaaaagatgtttttc
atatatgagtttgattccttgaagtccatccaccaggaagtcattcgggacatctgctcc
tcagagaactgtaagagccagaaagctgacatcatcttcttgattgatggctcagaatcc
atcgctcctaaagactttgaaaagatgaaggacttcatggagaggatggtgaaccagtct
aatatcggtgctgatgaaattcagattggccttctgcagttcagctccaatccccaggaa
gaattcaggcttaaccggtactcctcaaaggtggacatgtgcagagccatcttgagtgtc
caacagatgagtgatggtacccatactgggaaagccttgaatttcactctgccctttttt
gacagttcaagaggagggagacccagagttcatcagtatttgattgtgatcaccgacggg
gtctcccaggataatgtagctcccccagccaaagccctcagggacagaaacataattatt
tttgctatcggggtgggaaatgttcaaagagcccagcttttggagatcaccaatgaccag
gacaaagtattccaggaggaaaattttgagtccctgcagagcctggaaaaggaaattctt
tctgaggtctgtagttcccaaggctgcaacatagatctgtctgtaggagttgatacctca
acctcttcagagcgagctcagcaggagcttcgaaggttgctgccggagctgatgcaacag
ctggcttttctctctaacatcagctgtgaggctcctggccagatggagccgaggttccga
tatgtggttccaggctccagcgaccagcctgtctttgattccggctttgagaaatacagc
gatgagaccatccagaagttcttggtgcatcagggttctgtaaacaaccgtatggatgta
gactttctgcagtccctgggagagactgccattcacctgtctcttgctaaagtgaaggtc
cttttagtgtttacagacggacttgatgaagacctagagaggctgaggagaacctcagag
ttccttcgcagcagagggctctccggactgctgctcatcggcctgggaggtgcacataag
ttagaagagctgcaggagctggagtttggcagagggtttgcctacaggcagcctctgagc
tccagtctgccatccctcccaagcgtcttactgaagcaactcgacacaattgtggagagg
acatgctgtaacatgtatgccaaatgttacggagacgatgggatcagaggtgaacctggg
agtcgaggggagcagggagagaggggtttggacgggctccctggccatcctggtgaagag
ggagaccacggacaaagaggcccccgaggtcttcctggacttcgaggtgaggaaggatgt
ccaggtgtgagaggacctaagggagcaagaggattttcaggagagaagggcaaccctggt
gaggaaggtgttgggggcttggatggagaacagggcgatcgtggagccgcagggccatct
ggagagaaaggaagcagcggcagtcggggcttgacaggtctgcctggaccagctggacct
cgtggggagcctgggctgaggggagatccgggggatcctggaattgataatctcatccaa
ggccccaagggagaaaagggaaggcgtggacatcagggaagccctggtttccatggacct
ctgggggaagccggcagtgtgggacctcgggggtcacttggaagacatggcttgccaggg
ttgaagggtgtgcttggagaaaccggtgagctgggttcccgaggagagcctgggcatcca
ggcccacagggacccagaggaaggcaaggaccaccaggatttttcggtcaaaaaggggat
ccgggtacccaggggaatcctgggcttccagggccaagtggctcaaaaggaccagatgga
cccagaggactgaagggagaagtcggtcctgcaggagaaagaggtccacggggtcagcaa
ggcccaagagggcagcctggtcttttcggtccagacggccatggttatccgggaagaaaa
ggcaggaagggtgaacctgggttccctggctatcctggtgtgcaaggagaagatggtaac
ccaggccgtggaggagagaagggggccaagggaatccgagggaagaggggcaattctgga
tttcctgggcttgctggaactccaggtgaccaaggcccaccgggaaaaatgggcaccaaa
ggctcgaaaggcttggcagataggacgccttgtgaaattgttgacttcgtgcgaggaaac
tgcccttgctcaacaggtatttccaggtgcccagcattcccaacagaagtggtcttcacc
ttggacatgtccaacgatgtcgccccatcagactttgagaggatgagaaacattttatta
tctctgctgatgaagctggaaatgtgcgagagcaactgtcccactggtgcccgagtggcc
attgtttcctacaacacgaggacagattacctagtgcgcttgtcagaccatcggggaaaa
gctgcccttctgcaggctgtcaggaaaatccccctggaacgctcatctgggtctcggaac
cttggggccactatgaggtttgtggctagacacgtattcaaacgtgtacgctcaggcctt
ctggtgaggaaggtggccgtgttcttccaggcaggtaggaactatgacacagcctctgtc
agcacagccacgttggagctccacgcagcggacattgctacagcagttgtgaccttcaca
gaggagcacaacctcccagaggcagggctggtggatggacccaacgaatttcacctgttt
acgtgggagaccgagggccagcaggatgtggaacgcctggccagctgtactctctgctat
gacaagtgccgaccagccctggggtgccagctgcgtgctcctgggcctcagaagttggac
atggacttggtattcctggtggacagctcccagggtgtcagcagggacatataccttggg
gctttgcggctagtggattcagtgctcaaggacctggaggtggctgcgcagcctggcaca
tcctggcacggggcgcgcgcagccctgttgacacacacaaccccaggcttttggcctggt
gtggatcaagcccctgtgcttgagtacttccacctgacctcccacggccaccggacagaa
atgcaaaggcagattcgggaggctgcgagtggcctgctacagggaggccccgccctgggc
cacgccctggagtggacgctggaaaacgtgcttctgacagccgtactgcctcggaggtca
cgggtcctctatgccatcgtggccagcgagacaagcatctgggacagagagaagctaagg
actctgtcccaggaggccaagtgcaagggcatcgcattattcgtgctcgccgtgggccct
ggagtgggcgcccaggagctggctgagctggccaaagtggccagtgcgccctgggagcag
cacctgctacgcctagagggtgtctcagaggcagaggtggcctatgccagcagattcacg
gaggccttcctgaaccttctaaatagtggaataaaccagtatccacccccagagcttgtt
aaggagtgtggaggcccaaaccgtggggacaccttgctgcatttcttcacttctgccaag
aggttttccaggagccagtctggcacgtctgctgcctttgcgaatgactcagaagcactc
aagtcacagggcatctttctaggggagaggaaaagcagggtggcgtccgtagctctgcaa
gaagcgttgggaagtcatgggaaggacagggcggacactgaagacattgatcaggaaacg
ccagcaaaaggaagacatttgggccccacccacggtccttgtcccatgggtcctgaggaa
ggcgagtgcctgaattatgtcttgaagtag

KEGG   Mus musculus (mouse): 81877
Entry
81877             CDS       T01002                                 

Gene name
Tnxb, TN-MH, Tn, Tn-mhc, Tnx
Definition
(RefSeq) tenascin XB
  KO
K06252  tenascin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05165  Human papillomavirus infection
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    81877 (Tnxb)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    81877 (Tnxb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    81877 (Tnxb)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    81877 (Tnxb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81877 (Tnxb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    81877 (Tnxb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   81877 (Tnxb)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin DUF2369 DUF4998 fn3_2 DUF4959 hEGF
Other DBs
NCBI-GeneID: 81877
NCBI-ProteinID: NP_112453
MGI: 1932137
Ensembl: ENSMUSG00000033327
Vega: OTTMUSG00000037253
UniProt: E9Q2T3
Position
17 B1; 17 18.24 cM
AA seq 3126 aa
MAAQCTPSILTILVLLGLARAGPFSPRSNVTLPAPRPPPKPGGPSSQLYEHTVEGGEKQV
VFTHRINLPPSAGCGCPPGSEPPVPASEVQALRVRLEILEELVKGLKEHCTGGCCPTAAQ
AGTGQTDVRSLCSLHGVFDLSRCACSCEPGWGGPTCSDPTDTKTPTSSPPSKSCPEDCND
QGRCVRGRCVCFPGYSGPSCSWPSCPGDCQGRGRCVKGVCVCRAGFSGPDCSQRSCPRNC
NQRGRCEEGRCVCDPGYSGEDCGVRSCPRGCSQRGRCENGLCVCNPGYSGEDCGVRNCPR
GCSQRGRCEDGRCVCDPGYSGEDCSMRTCPWDCGDGGRCVDGRCVCWPGYSGEDCSTRTC
PRDCRGRGRCEDGECICDAGYSGDDCGVRSCPGDCNQRGHCEDGRCVCWPGYTGADCSTR
ACPRDCRGRGRCEDGVCVCHAGYSGEDCGVRSCPGDCRGRGNCESGRCVCWPGYTGRDCG
TRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGHCENGVCVCAVGYSGDD
CSTRSCPSDCRGRGQCLNGLCECDEGYSGEDCGIRRCPRDCSQHGVCQDGLCMCHAGYAG
EDCSIRTCPADCRRRGRCEDGRCVCNPGYTGPACATRTCPADCRGRGRCVQGVCMCYVGY
SGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRSRGECIQGR
CVCQEGYAGDDCGEEIPAIQNMRMHLLEETTVRTEWTRAPGPVDAYEIQFIPMTEGVSPP
FTARVPSSASAYDQRGLAPGQDYQVTVRALRGTSWGPPASKTITTMIDGPQDLRVVAVTP
TTLDLSWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADRTQLTDLMPGVEYVVTVTAERG
HAVSYPASIRANTDRAQEQPGKPSVQPRLGELTVTGLTSDSLLLHWTVPEGEFDSFLIQY
KDKDGPQAISVEGPQRSTPISGLEPGRKYKFILYGLIGKKRHGPLMAEAKILIQSDPDPG
SPPRLGELWVTDPTPHSLHLSWTVLGGQFDSFVVQYRDKEGQPRVVPVEGPDRSVVISPL
DPNRKYRFTLFGIANKKRYGPLTADGTTAAETKEESSEPPRLGELTVTGVTPDSLRLSWT
VARGPFDSFVILYKDAQGQPQSVPIEGDENEVTVPGLESNRKYKMNLYGLRGRQRVGPVS
VVAKTAPPDVVDQPLSPPEPSTEAPEPPEKPLLRELIVTDTTPNSLSLSWTVSEGQFDQF
VIQYKNGDGQPKVVRVPGHEDQVTISGLEPDHKYKMNLYGIHSGQRVGPVSVVGVTAAEE
EPPSPTEPSTEAPEPTEEPLLGELTVTGSSPDSLSLSWTVPQGDFDSFTVQYKSSDGRPQ
VMRVGGQEREVIVRDLDPGHKYKMNLYGLHEGHRVGPVSTVGTTDKQPEEKPPLEPRLEE
LTVTGVTPNSVSLSWIVPEGQFDSFVVQYQDRDGQPREVPLTAEQREVTVLDLDPARIYK
MNFYGLHGRRRVGPLSVSAMTAPAPATEASKLLPEPRLGELTVTDVTPDSVGLLWTVPEG
EFDSFTVQYKDRDGQPHVVSVAADLREVTIPGLEPSRKYKFLLFGVQDGKRRSQVSVEAK
TATHDDTSPGAPPRLGELWVTDPTTDSLRLSWTVPEGHFDSFVVQFKDKSGPRVVPVKGQ
ERTATITALDAGRKYRFLLYGLLGRKRFGPLTAEGITEPTNAADHTKSRLGEELRVTGVT
QNSVDLSWTVSEGQFDSFVVQYKDRDGQSQVVPVDGSHREVRVSGLDPGRRYKLLLYGLR
DSKRVGPLSVIAVTDPRETTEAWTEVPTTSTPAAVPRLGELRVEEATPHSLHLSWVVTEG
EFNSFEVQYTDRDGQLRVASTEGDQTDITLTGLESNHRYLITLYGFHDGQPVGSAQIEAL
TVPWEEEEEEEESTEPPTMTPEPRPQLGELTVTDATPDSLSLSWTVPEGQFDQFVIQYKN
GDGQPKVVRVPGHEDQVTISGLEPDHKYKLNLYGIHSGQRFGPVSTVGVTAAVEEPPSPT
EPSIEAPEPTEEPLLGELTVTGSSPDSLSLSWTVPQGDFDSFTVQYKDSDGRPQVMRVGG
QEREVIVRDLDPGRKYKMNLYGLHEGRRVGPVSTVGVTASLTTEPPIEPRLGELAAVEVT
SSTVHLSWTVAQGPFDSFLVQYKDTQGQPQMVPVSGDLGEVTVSGLEPARKYKFLLFGLK
DGKRHGPVSTEAKTVSDAKLLPRLGELTVTDTTQNSVGLSWTVPEGEFDSFLVQYKNRGG
QVQVVPAAADQREVTISSLEPNRKYRFLLFGLIGLKRLGPVSVEGTTAPVEKTPQPRLGE
LSVTEETSDSMHLSWSVAQGPFDSFLVQYKDRDGQLQTVSLAADQREVTIEGLQPGRKYK
FLLYGLTGGKRLGPISALGVTASEVDISAPDHTEPPHAPGLGTLAVTEATPDSLRLSWAV
ARGPFDSFVVQYQDTENETQALLVDGDQDKVLISGLEPKTSYKFFLYGLREGTRHGPVSV
EGTTDPVPAGQGPGDPGPRLSQLSVSDVTTSSLRLNWEAPLGAFDSFLLRFGVPLLSTLE
QNPRTLQQRELMVPGVRRSAMLRDLRPGTLYSLTLYGLRGPHKADSIQGTARTLSPVLES
PRDLQFSDIGETSAKVKWVPPTSRVDSFKISYQLADGGEPQSVQVDGRTQTQILQGLIPD
TRYEVTVVSVRGFEESEPLTGFLTTVPDGPTQLRALNLTDGSALLHWKPPHKPVDKYDVE
VESPGAPPLQASAPGSAVDYPLTDLALDTNYTATVRGLRGPNFTSPASITFTTGLKPPQD
LEAKEVTPRTALLTWTEPEVPPTGYLLSFDTPGGQIQEILLPAGTTSHRLLRLFPSTFYS
AQLRAIWGESLTPPVLTSFTTGGLRIPFPRDCGEELKNGPSASKTTTIFLNGNRERPLDV
FCDMETDGGGWLVFQRRMDGQTDFWRDWEEYAHGFGNISGEFWLGNEALHSLTQAGDYSL
RVDLRAGKEAVFAQYDFFRVDSAKENYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNNL
LISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFQ
VPTRGT
NT seq 9381 nt   +upstreamnt  +downstreamnt
atggcagctcagtgcaccccgtctattctgaccatcctggtgttgcttggcttagccaga
gcaggcccattctctcctcggtctaatgtgacacttccggccccacggccccctcccaag
cccggtggtccttcttctcagctgtacgagcatactgtggaaggaggagagaagcaggtg
gtgttcacccatcgcattaacctgcccccgtcagccggctgcggctgtcccccgggctct
gagcccccggtgcctgcttcagaggtgcaggccctgagggtccgcctggagatcctggag
gagctggtaaaagggcttaaggagcactgcacaggaggatgctgtcccactgcggcccaa
gctggcacaggccagactgacgtgcgcagcctctgcagcctccacggtgtctttgacctg
agccgctgcgcctgttcctgtgagcctggctggggtggacccacctgctcagaccctacg
gacacaaagacgcccacctcatcgccgccctccaagtcctgtcccgaagactgcaacgac
cagggacgctgcgtccgaggacgctgcgtgtgcttccccggctacagtggccccagctgt
agctggccctcttgccctggagattgtcaggggcgcgggcgctgcgtgaagggcgtgtgc
gtgtgtcgcgcgggcttctcaggccctgactgcagccagcgctcttgccctcgcaactgc
aaccagagaggacgctgcgaggaaggacgctgcgtgtgtgaccccggctactccggtgag
gactgtggggtgcggagctgtcccaggggatgcagccaaagaggccgctgcgagaacggc
ctctgcgtgtgcaaccccggctactctggcgaggactgtggggtgcggaactgtcccagg
ggctgcagccagaggggtcgctgcgaggacggccgctgtgtgtgcgatcccggctatagt
ggcgaagattgcagcatgaggacctgcccatgggactgtggcgacggagggcgctgcgtg
gacggtcgctgcgtgtgctggcccgggtactcgggcgaagactgtagcacgcggacgtgc
ccgcgtgactgccgtggccggggccgctgcgaggacggggaatgtatctgtgacgcaggc
tacagtggcgacgactgcggtgtgcggagctgccccggggactgtaaccaaaggggccac
tgtgaggatggccgctgcgtgtgctggcccgggtatactggagcggactgtagcacgcgc
gcctgcccacgggactgcaggggccgcgggcgctgcgaggatggcgtgtgcgtgtgccat
gcgggctacagcggcgaggactgcggggtgcgcagctgccccggggactgtcgcggccgt
gggaactgcgagagcggccgctgcgtgtgctggcctgggtacacaggccgagactgtggc
acgcgtgcctgccccggtgactgtcgtggacgcgggcgctgcgtggacggccgctgcgtg
tgcaatccgggcttcactggcgaggactgcgggagccgtcggtgtcctggggactgtcgc
ggacacggccactgcgagaacggcgtgtgcgtgtgcgctgtgggctactctggcgacgac
tgcagcactcgcagctgtcccagcgactgcagaggccgcggccagtgcctgaatgggctc
tgcgagtgcgacgaaggctactcgggtgaggactgtggcataagacggtgtccccgcgat
tgcagccagcacggcgtgtgtcaggatggcttgtgcatgtgccacgcaggctatgcgggc
gaagactgcagcattcgcacctgcccggccgactgtcgccggcgtggccgctgtgaggac
gggcgctgtgtgtgcaacccaggctacaccgggcccgcatgtgccactcgaacctgtcca
gctgattgtcgtggccgtgggcgctgcgtgcagggagtgtgcatgtgctacgttggctac
agcggtgaggactgtggacaggaagagcctcctgctagtgcctgccctgggggctgtggg
ccgcgggaactgtgccgcgccggacaatgcgtgtgtgttgagggctttcgaggcccagac
tgtgccatccagacgtgcccaggtgactgtcgcagcaggggagagtgtatccagggcaga
tgcgtctgccaagaaggctacgctggggacgactgcggggaagagataccagccatccag
aacatgaggatgcatcttctagaggagacaacagtccggacagagtggacacgagctccc
ggtcctgtggatgcctatgaaatccagtttatccccatgaccgagggggtgagtccacca
ttcacagctcgggtgcccagctctgcctcagcctatgaccagcgaggactggcgcctgga
caggactaccaggtcactgttcgtgctctacgagggaccagctggggtcctcctgcctct
aagaccatcactaccatgatcgatggtcctcaggacctccgggtggtagctgtgaccccg
accacactggatcttagctggctgcgcccccaggctgaggtggaccgatttgtggtgtcc
tatgtcagtgctggaaaccaaagggtgcgactggaagttccccctgaggcagacaggact
cagctaaccgatctgatgcctggtgtggagtatgtggtgactgtcactgcagaaagaggc
catgcagtcagctacccagcttctatcagggcgaatacagacagggctcaggaacagcct
gggaagccatcagtccagccacgcctgggtgaactgacagtgacaggcctgacctctgat
tccctgctcctgcactggactgtcccagagggggagtttgactccttcctgatccagtac
aaggacaaagacgggccccaggcgatatccgtggagggaccccagcgttctacacccatc
tcaggcttggaaccaggacgcaagtacaaatttatcctgtatggactcatcggcaagaag
aggcatggcccacttatggctgaagccaagatcttgattcagagtgaccctgacccagga
tccccaccccgcctgggagagctatgggtgacagaccccactccacactcattgcacctc
tcctggactgttctcggaggccagttcgactccttcgtggtccagtacagagacaaggaa
ggccagccccgtgtggtacctgtggaggggcctgatcgctcagtggtgatctccccactg
gaccccaatcgcaagtacaggttcactctgtttgggattgccaataagaagcggtacggg
ccccttactgctgatggcactactgctgcagagacgaaagaggagtcctcagagccgccc
cgcctcggcgaactgactgtgactggtgtgaccccagactccctgcgcctgtcctggaca
gtggcccggggtcccttcgactcctttgtaatcctttacaaggatgcacagggccagccc
cagagtgtacccatcgaaggtgatgagaatgaggtcactgtccccggcctggagtccaac
aggaagtataagatgaacctctacgggcttcgtggcaggcagcgtgtggggccggtatca
gtggtggccaaaactgccccaccagatgttgtagaccagcccctcagccccccagagccc
agcacagaggccccagagccccccgagaagccactcctgagagagctgatcgtgacagac
accacacccaactccctgagcctctcctggacagtctccgagggacagtttgaccagttc
gtgatccagtacaagaacggggatgggcagcccaaggtggtgcgggtgccaggacacgag
gaccaggtcaccatctccggcctggagccagaccacaagtataagatgaacctgtatggc
atccatagtggccagcgtgtgggccccgtgtctgttgttggtgtgacagctgcagaggaa
gaaccccccagccccacagagcccagcacagaggcgccagaacccactgaggagccgctc
ctgggagagctgacagtgacaggatcgtccccagactccctgagcctctcctggaccgtc
ccccagggagactttgactccttcactgtccagtacaagagcagtgatgggcggccccag
gtgatgcgtgtcgggggccaggagagggaggtcatcgtgagagacctggatcctgggcac
aaatacaagatgaacctgtatggactccatgaggggcatcgtgtgggccctgtgtccact
gtgggcacaaccgacaaacaaccagaagaaaagcccccccttgagccacgcctggaggag
ttgacagtgactggtgtaacccccaattctgtgagcctctcgtggatagttcctgaggga
cagtttgactccttcgtggtccagtaccaggacagggatgggcagccccgggaggtacca
ctgacagcagaacagcgtgaggtcactgtccttgacttggaccctgcaagaatatacaaa
atgaacttctacgggctacacggtagacgacgtgtgggccccctctccgtgtcagcaatg
acagcaccagctccagccaccgaggcctccaagctgctcccagaaccacgactgggggaa
ctaacagtgacagatgtgaccccggactcagtgggcctcctgtggactgtccctgagggt
gaattcgactccttcacggtccagtacaaggacagggatggccagccccacgtggtgtct
gtggcagcagacctacgggaggtcaccatcccaggcctggagccctctcgcaagtacaag
ttcctgctctttggggtccaagatgggaaaagacgcagccaggtctctgtagaggcgaag
acagctacccatgatgacaccagcccaggggcccctccccgccttggagagctgtgggtg
acggatcctaccacggactctctgcgcctatcctggacagttcccgagggccactttgac
tcttttgtggtccagttcaaggacaaaagtgggcccagggtggtgccagtaaagggtcaa
gagcggacagccactatcacggccctggatgctggccgcaagtacagattcctcctctat
gggcttctgggaaggaaacgctttggccccctcactgcagagggcataacagagcccacg
aatgctgcggaccacacaaaatctcgactgggagaggaactgcgggtgactggtgtgact
caaaactccgtggacctctcctggacagtctccgagggccagtttgactcctttgtggtc
cagtacaaggacagggatgggcagtcccaggtggtgcctgtggacggaagccatagagag
gttagagtctctggtctagacccaggtcgcaggtataagctgctactctacggcctccga
gacagcaagcgtgtgggtcccctttcagtcattgctgtgaccgaccccagagaaacaaca
gaagcttggacagaggtccccacaacttcaactcctgcagctgtgccccgcctcggggag
ctgagagtggaggaagccacgcctcacagcctgcatctctcctgggtggtgactgaggga
gaatttaactccttcgaggtccagtacactgacagagatgggcaactcagagtggccagt
acagagggtgaccagactgacattacccttactggcctggaatcgaaccacagatacctg
ataaccctatatggcttccatgatgggcagcctgtaggctctgctcaaattgaggccctg
acagtgccgtgggaggaagaagaggaggaagaggagtccacagagccacccaccatgact
cctgagcccaggccacaactgggagagctgaccgtgacagatgccacccctgactctctg
agcctttcctggacagtccccgagggacagtttgaccagttcgtgatccagtacaagaac
ggggatgggcagcccaaggtggtgcgggtgccagggcatgaggaccaggtcaccatctct
ggcctggagccagaccacaagtacaagttgaacctgtatggcatccacagtggtcagcgt
tttggccccgtgtctactgttggggtgacagctgcagtggaagagccccccagccccaca
gagcccagcatagaggccccagagcccactgaggagccactcctgggagagctgacagtg
acaggatcgtccccagactctctgagcctctcctggaccgttccccagggagactttgat
tccttcactgtccagtacaaggacagtgatgggcggccccaggtgatgcgtgtcgggggc
caggagagggaggtcatcgtgagagacctggatcctgggcgcaagtacaagatgaacctg
tatgggctccatgaggggcgtcgtgtgggtcccgtgtcgactgtgggtgtgactgcctct
ctgaccacagagccccccatagagccccgcctgggagagctggctgcagtagaagtgact
tccagtacagtgcacctgtcctggactgtggcccagggccccttcgactccttcctggtc
cagtacaaggacacacaggggcagccccagatggtgcctgtgagtggagacctgggtgag
gtcaccgtctcaggtttggagccagcccgaaagtacaagtttctactctttggactcaag
gatgggaagcgccatggccctgtctccacagaagcaaagactgtctctgatgcaaagctg
cttcctcgtcttggggagctcaccgtgacagacacgacccaaaactccgtgggtctctcc
tggactgttcctgagggtgaattcgactctttcttagtccagtacaagaacaggggaggg
caggtccaggtcgtgcctgcagcagcagaccaacgtgaggtcaccatctccagcctggag
cccaatagaaaatacaggttcctgctcttcggcctcataggcctcaaacggctggggcct
gtctccgtggagggcaccacggctcccgtggagaagacaccacagccccgcctcggtgaa
ctgtcagtgacagaggagacctctgactccatgcacctctcttggtctgtggcccagggt
ccctttgactccttcctggtccagtacaaggacagggatgggcagctccagacggtgtcc
ttggctgcagaccagcgagaggtcaccatagagggtctacagccaggcaggaaatacaag
ttcctgctctatgggctcactggagggaagcgcctgggacccatctctgccttgggagtg
acagcctcagaagttgacatatcagccccagaccacactgagccccctcatgctcccggc
ctggggacgctggcagtgacagaggcaaccccagactccctgcgactctcctgggctgtg
gctcgtggcccctttgactcctttgtggtccagtaccaggacacagagaatgaaacccag
gccctgcttgttgatggagaccaggacaaagtcctcatctcaggcctggaacccaaaact
tcctacaagttcttcctctatggcctccgtgaagggacacgccacggacctgtgtctgta
gagggcaccacagatccagttcctgctggtcagggcccaggggaccccgggccccgcctg
tcccagctctcagtttcagatgtgaccaccagttctctgcggctaaactgggaagccccg
cttggggcctttgactctttcctgctacgctttggggtccccctactgagtaccctggag
cagaatcctcgcactctgcaacagcgagagcttatggtgccaggcgtgcggcgatccgcc
atgctccgggacctgcgtcctgggaccctgtatagccttactctgtatgggctgcgtggg
ccacacaaggcagacagcatccagggcactgcccgcacactcagcccagttctggagagc
ccccgggacctgcaattcagcgacatcggggaaacatcagccaaagtcaaatgggtgccg
ccaacgtccagggtggacagcttcaaaatctcctaccagctagcagatggaggagagcca
caaagtgtgcaggtggatggccggacccagacccagatcctccaagggctgattccagac
actcgctatgaggtgactgtggtctccgtccgtggctttgaggaaagcgagcctctcaca
ggcttcctcaccacagtgcctgatggtcccacccagctacgggcattgaacttgactgac
ggatctgcccttctacactggaaacccccccacaaaccagtggacaaatatgacgtcgag
gtcgaatcccctggggccccaccccttcaggcctcagcacctggcagcgctgtggactac
ccactgactgacctggcactcgacaccaattacacagccaccgtgcgtggtctccggggt
cctaacttcacctccccagccagcataaccttcaccacagggttaaagcccccccaggac
ttggaggccaaggaagtgactcctcgcacggccctgctcacttggactgagcctgaagtc
ccacccacaggctacctgctcagctttgacacccctggaggacagattcaggaaatcctg
cttccagcaggaaccacctcgcacaggcttctgcgcctcttcccctccaccttctacagt
gcccagctgcgggccatctggggcgagagccttacacctcccgtgctcacttcctttact
actggtgggctgcggatccccttcccccgggactgtggggaggagctgaagaatgggccc
agtgcctcaaagaccaccaccatcttcctcaatggcaaccgtgagcggcctttggatgtg
ttctgtgacatggagactgatggaggtggttggctggtgttccagcgccgcatggatgga
cagacggacttctggagagactgggaggagtacgcccatggttttgggaacatttccggg
gaattctggctgggcaacgaggccctgcacagcctaacacaggctggagactattctctg
cgtgtggacctgcgggccggaaaggaagccgtgttcgcccagtatgacttcttccgtgta
gactcagcaaaggagaactaccgcctacaccttgagggctaccatgggactgcaggcgac
tctatgagctaccacagtggcagtgtcttttctgcccgtgatcgagaccccaacaacttg
ctcatctcttgcgctgtctcttatcgtggggcttggtggtacaggaactgtcactacgcc
aacctcaatgggctctatgggagcacagtggatcaccagggagtgagctggtaccactgg
aagggcttcgagttctctgtgcccttcacggaaatgaagctgcgacccagaaacttccag
gtccccaccaggggcacctga

KEGG   Mus musculus (mouse): 94216
Entry
94216             CDS       T01002                                 

Gene name
Col4a6, BB116301
Definition
(RefSeq) collagen, type IV, alpha 6
  KO
K06237  collagen type IV alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    94216 (Col4a6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    94216 (Col4a6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    94216 (Col4a6)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    94216 (Col4a6)
  09154 Digestive system
   04974 Protein digestion and absorption
    94216 (Col4a6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    94216 (Col4a6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    94216 (Col4a6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    94216 (Col4a6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    94216 (Col4a6)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    94216 (Col4a6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    94216 (Col4a6)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    94216 (Col4a6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   94216 (Col4a6)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   94216 (Col4a6)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 94216
NCBI-ProteinID: NP_444415
MGI: 2152695
Ensembl: ENSMUSG00000031273
Vega: OTTMUSG00000018922
UniProt: Q9ESQ1 B1AVK5
Position
X; X F1- F2
AA seq 1691 aa
MHPGLWLFLVSLCLTKELAESGQKMSYGKPCGSRDCHGVCTCFPEKGARGHPGPIGTQGP
AGPEGFTGPTGLSGLKGERGSPGPLGPYGSKGDKGPIGVPGFVGISGIPGHPGQPGPRGP
PGPDGCNGTQGAVGFPGPDGYPGILGPPGLPGHKGAKGEPVPFQGSITGIRGDPGLPGLD
GIPGPSGSSGSPGDAGPIGPPGLQGPPGLPGLPGPEGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGPPGFPGMSGPPGVPEFGSTGEKGEKGILGLPGPRG
PMGSEGIQGHPGRQGKKGTSGFPGINGFPGIKGEKGDIGVRGPDSFTDADGAVISGYPGD
PGVLGLPGLRGDEGVQGQRGPSGTPGLPSLTGLPGALGPQGFPGLKGDQGNSGRTTFGEA
GLPGRVGLPGLPGLPGPSGPPGRTFETGHLSNIEPGFPGLQGEQGPKGHQGLKGVKGDSG
FCACEGGAPNIGPHGEPGLPGIQGPIGLQGFKGTKGDPGSRGASGPAGTPGLFGPRGQTG
LKGKKGEPTVSRGSKMSGDKGDPGPQGTPGLAGTPGKDGRPGLPGLPGIQGDGGSGFPGE
RGLPGLPGEKGHDGPIGPPGIGLPGPPGPRGLPGDKGVDGLPGQQGLRGAQGVTLPCIIP
GSYGPSGFPGAPGFPGSKGARGLPGIPGKPGTHGSKGGPGSPGLMHLPGLPGFPGVRGEK
GLPGFPGLPGKDGYPGKAGSPGLPGFKGAAGDIFGAENGASGEQGLQGLPGDKGFPGDSG
LPGPKGLNGKPGMLGPKGERGNPGTSGPPGQPGPSGSTDPFGIKGTSGFPGAPGLPGISG
HPGKKGQRGDIGQPGSTGKRGLPGIKGLPGPQGSPGFLGSPGLSGVTGLPGIEGQKGEKG
SSGPVGFPGLPGLPGLPGADGLKGFSGSFGKVGQPGQTGTSGEKGDRGDPGPVGISSPRP
PMLNLWFKGEKGSRGSAGSDGFPGPRGDKGEPGIPGLPGPPGATGQTNTIKGLNGRPGSP
GSMGRRGLPGLKGSLGIAGFPGMPGKSGSQGLTGTSGLLGATGIPGLKGDQGQTLGISGS
PGPKGQPGELGFKGVKGKDGLVGDRGYPGNKGDGGKVGITGDPGFPGSPGLQGISGMNGD
PGLPGSSGHLGSIGRPGPSGLIGPKGFPGAPGLHGLNGLPGTKGTHGTPGASITGVPGPA
GLPGPKGERGVPGIVIGDPGKQGSKGQKGDQGSPGLQGPAGTPGAPGISLPSVIAGQPGD
PGRPGLDGERGRPGPPGPPGPPGPSSDQGDPGDSGFPGIPGLQGFKGNQGLPGFSGLSGE
LGLKGMRGEPGLMGTPGKIGQPGDPGFPGMKGKAGPRGFSGPQGAPGHTPIAEAMQVPPG
PLGLPGIDGIPGLIGDPGSQGSVGLQGSKGLPGIPGKDGPSGLPGPSGILGDPGLPGLQG
PPGFEGAPGNQGPIGQPGMPGHGVRVGYTLVKHSQSEQVPLCPTGMSRLWVGYSLLFVEG
QEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVGQTQ
IPQYISRCSVCEAPSQAIAVHSQDIIVPQCPLGWHSLWIGYSFLMHTAAGAEGGGQSLVS
PGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERGQFREEPVSETLKTGQLHTR
VSRCQVCMKTP
NT seq 5076 nt   +upstreamnt  +downstreamnt
atgcaccctggattgtggctgttcctggtttccttatgcttgaccaaagaactggcagaa
tcgggacagaagatgtcctatggaaagccatgtgggagccgagattgccatggagtctgt
acatgctttcctgagaaaggagcaagagggcaccctggaccaattggaactcaaggtcca
gccggtccggaagggtttactggtccaactggtttatcaggtttgaaaggagaaagaggc
tccccaggccctctgggaccatatggatcaaaaggagataagggtcccattggagttcct
ggctttgttggcatcagtggtattccgggccaccctggacagccaggtccaagaggtcca
cctggcccagatggctgtaatggaactcaaggagctgttggatttccaggccctgatggc
taccctgggattttaggaccacctgggctgcctggtcacaaaggtgccaaaggagagcct
gttccttttcaaggcagcattacaggaataaggggagatcctgggctgcctggactagat
ggaatccctggtccatcaggatcctccggctctcctggagatgcaggacccataggacca
ccaggcttacaaggtcccccaggcctccccggacttcccggtcctgagggaaatatgggg
ttaggtttccaaggagaaaaaggagtcaagggggatgttggcctccctggccctgcagga
ccacctccatctactggggaactagaattcatgggattccccaaaggaaagaaaggttcc
aagggtgagccagggcctccaggtttcccaggaatgagtggccctccaggtgtcccggaa
tttggatctactggagaaaaaggagaaaaggggattcttggtttgccaggacctaggggt
cccatgggttcagaaggaatacaaggccatccagggagacagggaaagaaggggacttca
ggttttcctgggattaacgggttcccaggaattaagggtgaaaagggagacattggtgtt
cgaggcccagacagtttcactgatgcagatggcgctgtgatctcaggttatcctggagac
cctggtgtgctgggccttccaggccttagaggagatgaaggcgtccaaggccaacgtggc
ccttctggaacccctggcctcccatcattaacaggtcttccaggtgccctagggcctcag
ggatttcctggcctgaaaggagaccaaggaaactcaggacgtaccacctttggagaagct
ggcctacctggcagggttggtttaccaggtttaccaggcctgccaggcccatcaggccca
cctggtcgcacatttgagactggacatctgtccaacatagagcctgggttccctggtctc
caaggagaacaaggtccaaaaggacatcaaggcctcaaaggagtaaaaggagactctggt
ttttgtgcttgtgaaggtggtgcccccaacattggaccacatggggaaccaggtctgcct
gggatacaaggtcccattggtctacagggttttaaggggactaaaggagatccaggctca
aggggagcatctggtcctgcagggacgccagggctatttggacctagaggtcagactggc
ctcaaaggaaagaaaggagaaccaactgtcagtagaggatcaaaaatgtcaggggacaaa
ggtgaccctggtcctcagggtaccccaggtttggcaggaactccgggcaaggatggaaga
ccaggtttaccaggcctcccaggcattcagggagatggtgggtctggcttcccaggtgaa
agagggttaccaggacttcctggtgaaaaaggccatgatggtccaattggaccaccagga
attgggctgccaggacctcctgggccccgtggacttcctggagataaaggagtagatggg
ttaccagggcaacaaggcctccgtggagctcaaggagtcaccttgccttgtatcattcct
gggtcatatggtccatcaggatttcctggagctcctggattcccaggctctaagggagct
cggggcctccctggaattccaggcaagcctggcactcacggaagcaaaggagggcctggg
agtccagggttaatgcatctcccaggattgccagggtttcctggagttcgtggggagaag
ggattacctgggtttcctgggcttcctggaaaagatggctaccctgggaaagctggcagt
ccagggttaccaggtttcaagggagctgctggtgacatatttggtgctgaaaatggtgct
tcgggggagcaaggcctacagggattgccaggggacaaaggatttcctggagactctggc
cttccaggacccaagggtttgaatgggaaacctggtatgctaggccccaagggtgagcgg
ggcaaccctggaacatcaggaccaccaggacagccaggaccctcagggtctactgaccca
tttggcatcaagggcacatctggattcccaggagcaccaggccttccaggcatctcaggg
caccctggaaagaaaggtcaaagaggagacataggtcagcctggatcaactggaaaaaga
ggtctacctgggataaaaggccttcctggtcctcaagggtcacctggcttcctggggagc
ccaggtttgtcaggcgtcactgggttgccgggcatcgaaggccaaaagggtgaaaagggg
tcctctggaccagtaggatttcctgggttacctggtcttcctggtcttcctggagctgat
ggattaaagggattttctgggtcatttggaaaggtgggacaacctggacagactggtact
tccggagaaaaaggagacagaggggatccagggccagttggcatatctagtccaagacct
ccaatgctaaacctttggttcaaaggagaaaaaggctctcgaggttctgctggatcggat
ggatttcctgggcccagaggtgacaaaggagagcctggcatcccagggttaccaggtcca
cctggagctactggacaaaccaataccatcaaagggctcaatgggaggccaggttctcct
ggatctatgggaagaaggggattacctggcctgaaggggtctcttgggattgcaggtttc
ccaggaatgccagggaaaagcggttcacaggggctcactgggacttctggcctcctggga
gcaactggtatcccaggtttaaaaggagatcaaggccaaacacttggcatttctggaagc
ccaggacccaagggacagcctggagaattaggttttaaaggtgtcaaaggaaaagatgga
ctagttggtgatagaggttacccaggaaacaaaggtgatggtggaaaagttggaattact
ggagatcctggcttccctggctccccaggacttcaagggatttcaggtatgaatggagac
ccaggcctcccaggttcctctggccatctggggtcaattggccgccctggaccctcaggc
ttaataggacctaaaggattccctggagctcctggtttacatggactgaatggacttcca
ggcaccaagggcacccatggcactccaggagccagtatcactggtgttcctgggccggct
ggcctgcctggtcccaaaggggaaaggggagtgccaggaattgtcatcggagatccaggg
aaacaaggttcaaagggacaaaaaggtgaccaaggttccccaggtcttcaaggtcctgct
ggtacccctggagccccaggcatctccttgccctcagtcatagcaggacagcctggtgac
cctgggcggccaggcctagatggagaacgaggccgcccaggccctccaggtcctccaggt
ccccctgggccatcctcagatcaaggcgatcctggagactctggcttccctgggattcca
ggccttcaagggttcaagggaaaccaaggacttccaggtttctctggcctctctggagag
ctagggctaaagggcatgagaggggaacctggcctcatggggactcctggcaagatcggg
caaccaggagacccaggatttcctgggatgaaggggaaggcggggccaagaggcttttcc
ggcccacagggagctccaggacacacaccaattgctgaagctatgcaggttcctccagga
cctttgggtctgccaggcattgatggtatcccaggcctcataggagaccctgggtctcaa
ggctctgtgggtctgcaaggttccaaaggcctacctggcatccctggtaaggatggcccc
agtgggcttccaggcccatctggaatccttggtgatcctggtctccctggactacaagga
cctccaggatttgaaggagctccgggaaatcagggccccattgggcagcctgggatgcct
gggcacggtgtgagagtgggctacacactagtaaaacacagtcagtcagaacaggtgcca
ctatgccccactgggatgagccggctctgggtgggttacagcttgctcttcgtggagggg
caggagaaagcccataaccaggatctgggatttgctggctcctgcctgccccgattcagc
accatgcccttcatatactgcaacatcaatgaagtgtgccactatgccagacgcaatgat
aaatcttactggctctccactactgcccccattcccatgatgcctgtgggccagacccag
attccccagtatatcagccgctgctctgtatgtgaggcaccctcacaagccattgctgta
cacagtcaggacatcattgtcccacagtgccctctgggctggcacagcctctggatcgga
tactccttcctcatgcacactgctgctggggctgagggtggaggccagtccctagtctcc
cctggctcgtgtcttgaggacttccgggccactcctttcattgagtgcagcggcgcccgt
ggtacatgccactactttgccaacaagtacagtttctggctgacaacggtggaggagaga
gggcagtttcgggaagagcccgtgtctgagacgctgaaaactgggcagcttcacaccagg
gtgagccgctgccaggtgtgtatgaaaaccccgtag

DBGET integrated database retrieval system