KEGG   Mus musculus (mouse): 12669
Entry
12669             CDS       T01002                                 

Gene name
Chrm1, AW49504, Chrm-, Chrm-1, M1, M1R
Definition
(RefSeq) cholinergic receptor, muscarinic 1, CNS
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04725  Cholinergic synapse
mmu04810  Regulation of actin cytoskeleton
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    12669 (Chrm1)
   04024 cAMP signaling pathway
    12669 (Chrm1)
   04151 PI3K-Akt signaling pathway
    12669 (Chrm1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12669 (Chrm1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12669 (Chrm1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    12669 (Chrm1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12669 (Chrm1)
   05022 Pathways of neurodegeneration - multiple diseases
    12669 (Chrm1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12669 (Chrm1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    12669 (Chrm1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 12669
NCBI-ProteinID: NP_001106167
MGI: 88396
Ensembl: ENSMUSG00000032773
Vega: OTTMUSG00000039794
UniProt: P12657
Position
19; 19 A
AA seq 460 aa
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaacacctcagtgccccctgctgtcagtcccaacatcaccgtcttggcaccaggaaag
ggtccctggcaagtggcattcatcgggatcaccacaggcctcctgtctctggctacagtg
acaggcaacctgctggtgctcatctccttcaaggtcaacacagagctcaagacagtcaac
aactacttcctgctgagcctggcctgtgctgatctcatcattggcactttctccatgaac
ctctataccacatacctgctcatgggccactgggctctgggcacactggcctgtgacctc
tggctggccctggactatgtggccagcaacgcctctgtcatgaatcttctgctcatcagc
tttgaccgttacttctcagtgacccgacccctgagctaccgagccaagcgcactccccgc
agggcagctctgatgattggcctcgcgtggttggtttccttcgttctctgggccccagcc
atcctcttctggcaatacctagttggggagcggacagtgctggctgggcagtgctacatc
cagttcctctcccaacccatcatcacttttggcacagccatggccgccttctacctccct
gtcacagtcatgtgtacgctgtactggcgcatctaccgggagacagaaaaccgagcccgg
gagctagcagccctacagggctctgagacaccaggcaaaggtggtggcagcagcagcagc
tcagagaggtcacagccaggagctgaaggctcacccgagtcacctccaggccgctgctgt
cgctgttgccgggcacccagacttctgcaggcctacagctggaaagaagaagaggaagag
gatgaaggctccatggagtccctcacatcctctgaaggtgaggagcctggctcagaagtg
gtgatcaagatgcctatggtagatcctgaggcacaggcacccaccaagcagcctcccaaa
agctccccaaatacagtcaagaggcccaccaagaaaggccgagaccgaggcggcaaaggc
caaaaaccccgagggaaggaacaactggccaagagaaagaccttctcactggtcaaggag
aagaaggcagctcggaccctgagtgccatcctgctggccttcatcctcacctggacacca
tataacatcatggtgctggtgtctacattctgcaaggactgtgttccagaaaccctatgg
gagctgggctactggctttgctacgtcaacagcactgtcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacactttccgcctgctgttgctctgccgctgggacaagcgg
cgctggcgcaaaatccccaagcgccctggctctgtgcaccgcaccccctcccgccaatgc
taa

KEGG   Mus musculus (mouse): 14062
Entry
14062             CDS       T01002                                 

Gene name
F2r, AI482343, Cf2, Cf2r, P, Par1, Th, ThrR
Definition
(RefSeq) coagulation factor II (thrombin) receptor
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04610  Complement and coagulation cascades
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14062 (F2r)
   04020 Calcium signaling pathway
    14062 (F2r)
   04072 Phospholipase D signaling pathway
    14062 (F2r)
   04024 cAMP signaling pathway
    14062 (F2r)
   04151 PI3K-Akt signaling pathway
    14062 (F2r)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14062 (F2r)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14062 (F2r)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    14062 (F2r)
   04611 Platelet activation
    14062 (F2r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14062 (F2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14062 (F2r)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Thrombin
    14062 (F2r)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 14062
NCBI-ProteinID: NP_034299
MGI: 101802
Ensembl: ENSMUSG00000048376
UniProt: P30558
Position
13 D1; 13 50.21 cM
AA seq 430 aa
MGPRRLLIVALGLSLCGPLLSSRVPMSQPESERTDATVNPRSFFLRNPSENTFELVPLGD
EEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYLTSPWLTLFMPSVYTIVFIV
SLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLPFKISYYFSGTDWQFGSGMC
RFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGRANFTCVVIWVMAIMGVV
PLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSAIFFLVPLIVSTVCYTSIIR
CLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYLFLSDSPGTEAAYFAYLL
CVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNSCNSTGQLMPSKMDTCSSHL
NNSIYKKLLA
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggggccccggcgcttgctgatcgtcgccctcggcctcagcctgtgcggtcccttgctg
tcttcccgcgtccctatgagccagccagaatcagagaggacagatgctacggtgaacccc
cgctcattctttctaaggaatcccagtgaaaatacatttgaactggtccccctgggggat
gaggaggaggaggagaaaaatgaaagcgtcctgctggagggtagggcagtctacttaaat
ataagcctccctcctcacacgccgcctcctcccttcatctccgaggacgcctccggatat
ctgaccagcccctggctgacgctcttcatgccctccgtgtacacgattgtgttcattgtc
agccttcctctgaacgtcctggccatcgcagtgttcgtcttgaggatgaaggtcaagaag
ccggccgtggtgtacatgctgcacctggccatggccgacgtgctcttcgtgtcggtgctc
cccttcaagatcagctactacttctccggcactgattggcagttcgggtctggaatgtgc
cgcttcgccaccgcagcgttttacgggaacatgtacgcctccatcatgctcatgacggtc
ataagcattgaccggttcctggcggtggtgtatccgatccagtccctgtcctggcgcact
ctgggccgagccaacttcacttgcgtggtcatttgggtgatggccatcatgggggtggtg
ccccttctcctcaaggagcagaccacccgagttccgggactcaacatcaccacctgccac
gacgtcctcagtgagaacctgatgcaaggcttttactcgtactacttctcggccttctcc
gccatcttctttcttgtgccgttgatcgtttccacggtctgctacacgtccatcatccgg
tgcctgagctcctccgcggttgccaaccggagcaagaagtcgcgggctttgttcctgtct
gccgcggtgttctgcatcttcatcgtctgctttgggcccaccaacgtcctcctgattgtg
cactaccttttcctctccgacagtcctggtacagaggcagcctactttgcttacctcctc
tgcgtctgtgtgagcagcgtgagctgctgcatcgatccgttgatttactactacgcctcc
tccgagtgccagaggcacctctacagcatcttgtgctgcaaagaaagctctgatcccaac
agttgcaacagcaccggccagctgatgccgagtaaaatggatacctgctctagtcacctg
aataacagcatatacaaaaagctattagcttag

KEGG   Mus musculus (mouse): 14745
Entry
14745             CDS       T01002                                 

Gene name
Lpar1, AI326300, Edg2, Gpcr, Gpcr26, Kdt2, L, lpA1, vzg-, vzg-1
Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14745 (Lpar1)
   04072 Phospholipase D signaling pathway
    14745 (Lpar1)
   04151 PI3K-Akt signaling pathway
    14745 (Lpar1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14745 (Lpar1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    14745 (Lpar1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14745 (Lpar1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14745 (Lpar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14745 (Lpar1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    14745 (Lpar1)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 14745
NCBI-ProteinID: NP_034466
MGI: 108429
Ensembl: ENSMUSG00000038668
Vega: OTTMUSG00000007519
UniProt: P61793 Q544V2
Position
4 B3; 4 32.2 cM
AA seq 364 aa
MAAASTSSPVISQPQFTAMNEQQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC
VFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIDHCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRNENPNGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcagctgcctctacttccagccctgtaatttcacagccccagttcacagccatgaac
gaacaacagtgcttctacaatgagtctatcgccttcttttataaccggagtgggaaatat
ctagccacagaatggaacacagtgagcaagctggtgatgggactgggcatcactgtttgc
gtgttcatcatgttggccaatctcctggtcatggtggcaatctacgtcaaccgccgcttc
catttccctatttattacttgatggccaacctggctgctgcagacttcttcgctggattg
gcctacttctacctgatgttcaatacaggacctaatacccggagactgactgttagcacg
tggctcctccggcagggcctcattgacaccagcctgacagcttctgtggccaacctgctg
gctattgctatcgagaggcacatcacggttttccgcatgcagctccatacacgaatgagc
aaccggcgcgtggtggtggtgattgtagtcatctggactatggccattgtgatgggtgct
atacccagtgtgggctggaactgcatctgtgatatcgatcactgttccaacatggcaccc
ctctacagtgactcctacttagtcttctgggccattttcaacctggtgacctttgtggtc
atggtggttctctacgctcacatctttggctatgttcgccagaggactatgaggatgtct
cggcatagttctggacccaggaggaatcgggacaccatgatgagccttctgaagactgtg
gtcattgtgcttggtgcctttattgtctgctggactccgggattggtcttgttattgctg
gatgtgtgctgcccgcagtgcgatgtcctggcctatgagaagttcttcctcctcctggcc
gagttcaactctgctatgaaccccatcatctactcctaccgcgacaaagagatgagcgcc
accttcaggcagatcctgtgttgccagcgcaacgagaaccctaatggccccacggaaggc
tctgaccgctctgcctcctccctcaaccacaccattctggctggagttcacagcaacgac
cactctgtggtttag

KEGG   Mus musculus (mouse): 243764
Entry
243764            CDS       T01002                                 

Gene name
Chrm2, AChR-M2, Chrm-, Chrm-2, M2
Definition
(RefSeq) cholinergic receptor, muscarinic 2, cardiac
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04725  Cholinergic synapse
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    243764 (Chrm2)
   04024 cAMP signaling pathway
    243764 (Chrm2)
   04151 PI3K-Akt signaling pathway
    243764 (Chrm2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    243764 (Chrm2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    243764 (Chrm2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    243764 (Chrm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    243764 (Chrm2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    243764 (Chrm2)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 243764
NCBI-ProteinID: NP_987076
MGI: 88397
Ensembl: ENSMUSG00000045613
Vega: OTTMUSG00000036825
UniProt: Q9ERZ4
Position
6; 6 B1
AA seq 466 aa
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGGTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDDNSRQTCIKIVTKTQKGDACTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgaataactcaactaactcctcgaacaatggtttggctattaccagtccttacaagaca
tttgaagtggtatttattgtccttgtggctggatccctcagtctggtgaccatcattggg
aacattctagtcatggtttccattaaagtcaaccgccaccttcagactgtcaacaattac
ttcttgttcagcctggcctgtgctgacctcatcataggtgttttctccatgaacttgtat
accctctacactgtgattggctactggcctttgggacctgtagtgtgcgacctttggcta
gccttggactatgttgtcagcaatgcctccgttatgaatcttctcatcatcagctttgat
agatacttctgtgtcacaaaacctctaacctacccagttaagcggaccacaaaaatggca
ggcatgatgattgcagctgcgtgggttctttccttcatcctctgggccccagccattctc
ttctggcagttcatcgtaggggtaaggactgtggaagacggggagtgctacattcagttc
ttttccaacgctgccgtcacctttggcactgccattgcggctttctatctgcctgtcatc
atcatgactgtgctctattggcacatatcccgggcgagcaagagcagaataaagaaagaa
aagaaggaaccagtggccaaccaagacccggtgtctccgagtctagtgcaaggaagaatt
gtaaagccaaacaacaacaacatgcctggtggtgatggtggcctggagcacaacaagatc
cagaatggcaaggctccgcgggacggtgggactgaaaactgcgttcagggggaggagaaa
gaaagctccaacgactccacgtctgtcagtgccgtggcctccaacatgagagatgatgag
ataacccaggatgaaaacacggtttccacttccctgggccactccaaagatgacaactct
aggcagacatgcatcaaaattgtcaccaagacccaaaagggtgacgcatgcacaccaaca
agtaccacagtagaactagtgggatcgtcaggtcagaatggtgatgaaaagcagaacatt
gtagcccgcaaaattgtgaagatgaccaagcagcctgccaaaaagaagcctcctccatcc
cgggaaaagaaagtgaccaggacaatcttggctatcctgttggctttcatcatcacgtgg
gcgccatacaatgtcatggtgctcatcaataccttctgtgcaccctgcatccccaataca
gtgtggacaattggctactggctctgttacattaatagcaccatcaaccctgcctgctat
gcactttgtaacgccaccttcaaaaagacttttaagcacctccttatgtgtcattacaag
aacataggcgctacaaggtaa

KEGG   Mus musculus (mouse): 381810
Entry
381810            CDS       T01002                                 

Gene name
Lpar5, GPR, GPR93, Gm1072, Gpr92, L, LPA5
Definition
(RefSeq) lysophosphatidic acid receptor 5
  KO
K08390  lysophosphatidic acid receptor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    381810 (Lpar5)
   04072 Phospholipase D signaling pathway
    381810 (Lpar5)
   04151 PI3K-Akt signaling pathway
    381810 (Lpar5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    381810 (Lpar5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    381810 (Lpar5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    381810 (Lpar5)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    381810 (Lpar5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 381810
NCBI-ProteinID: NP_001156740
MGI: 2685918
Ensembl: ENSMUSG00000067714
Vega: OTTMUSG00000022555
UniProt: Q149R9 G3X9K0
Position
6; 6 F2
AA seq 372 aa
MFANSSANTTSTNSSVLQCPDYRDTHRLHMVVYSLVLATGLPLNALALWVFLRVLRVHSV
VSVYMCNLAASDLLFTLSLPLRLSYYAQHHWPFPGFLCQTSGAIFQMNMYGSCLFLMLIN
VDRYAAIVHPLRLRHLRRPRVARRLCLGVWALILLFAVPAARVHSPSHCTYKNITVRLCF
ESFSDELWKGRLLPLLLLAEILGFLLPLAAVVYSSGRVFWTLARPDATQSQRRRKTVRLL
LANLIIFLLCFVPYNSTLAVYGLLRANLVKNSIQDRDQVRGVLMIMVLLAGANCVLDPLV
YYFSAEGFRNTLRNLGAPLNTRPLATNGAAGVLTELPSESTQNTGQDATSQVLLQPATLG
TPPDNCSQDSAL
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtttgccaattcttcagccaacacgacttctaccaacagctctgtgctccagtgccct
gactatcgagatacacatcgtttgcatatggtggtctacagcctggtattggcgactggt
ctccctctcaacgctctggctctctgggtcttcctgcgtgtactgcgcgtacactcagtg
gtgagcgtgtacatgtgcaacctggcagccagcgacttgctcttcaccctgtcacttccc
ctgcgcctctcctactatgcacagcaccactggccttttccaggcttcctgtgccagacg
tcgggcgccatcttccagatgaacatgtacggcagctgtctctttctgatgctcatcaac
gtggaccgctatgcggccatcgtgcacccgctgagactgcgccacctacggcggccccgt
gtggcacggcggctctgcctgggcgtgtgggctctcatcctgctgttcgctgtgcccgcc
gcccgcgtgcacagcccgtcccactgcacgtacaagaacatcactgtgcgcctgtgcttc
gagagcttcagcgatgaactgtggaagggcaggctgctgccgctcctgctgctggccgag
atactaggctttctgctgcccctggcggctgtcgtctattcgtctggcagagtcttctgg
acactggcgaggcccgacgccactcagagccaacggcgacggaagaccgtgcgcctcctg
ctggccaatctcatcatcttcctgctgtgcttcgtgccctataactccacgctggctgta
tatgggttgctacgggccaacttggtgaagaacagtattcaggaccgcgatcaggtgcgc
ggggtgctgatgataatggtgctgctggccggcgccaactgcgtgctggatccactggtt
tactacttcagtgccgagggtttccgtaacacccttcgcaacctgggcgccccgctgaat
accaggcctttggctaccaatggggctgcaggcgtgctcaccgaactaccctcagaaagc
acccaaaacactgggcaggatgccacaagtcaggttctactccagcctgccactctgggt
acacccccggacaactgctcccaggattcggctctctga

KEGG   Mus musculus (mouse): 53978
Entry
53978             CDS       T01002                                 

Gene name
Lpar2, Edg4, IPA2, L, LPA2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    53978 (Lpar2)
   04072 Phospholipase D signaling pathway
    53978 (Lpar2)
   04151 PI3K-Akt signaling pathway
    53978 (Lpar2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    53978 (Lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    53978 (Lpar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    53978 (Lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    53978 (Lpar2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    53978 (Lpar2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 zf-UBR
Other DBs
NCBI-GeneID: 53978
NCBI-ProteinID: NP_064412
MGI: 1858422
Ensembl: ENSMUSG00000031861
UniProt: Q6P290
Position
8 B3.3; 8 33.91 cM
AA seq 348 aa
MGQCYYNETIGFFYNNSGKELSLHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRF
HQPIYYLLGNLAAADLFAGMAYLFLMFHTGPRTARLSIKGWFLRQGLLDTSLTASVATLL
AIAVERHRSVMAVQLHSRLPRGRVVTLIVGVWAAALGLGLLPAHFWHCLCDLDSCSRMVP
LFSRSYLAAWALSSLLVFLLMVAVYTRIFFYVRRRVERMAEHVSCHPRYRETTLSLVKTV
VIILGAFVVCWTPGQVVLLLDGLDCKSCNVLAVEKYFLLLAEANSLVNAVVYSCRDAEMR
RTFRRLLCCMCLRWSSHKSARYSASAQTGASTRIMLPENGRPLMDSTL
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgggccagtgctactacaacgagaccatcggctttttctataataacagcggcaaggag
ctcagccttcactggcgccccaaagatgtggtggtggtggccctggggctgacagtcagt
gtgctggtattgctgaccaatctgctggttattgcagccatcgcctccaaccgacgcttc
caccagcccatatactacctgcttggcaacttggctgcggctgacctcttcgctggcatg
gcctacctcttcctcatgttccatactggcccacgcactgccaggctctccatcaaaggc
tggttcctgcgacagggcctgctggacaccagcctcacggcgtcagtggccacactgctg
gccatcgctgtggaacggcaccgcagtgtgatggcggtacagctacacagccgcctgccc
cggggccgtgtggtcacactcatcgtgggtgtgtgggcggctgcactgggtctggggttg
ctacctgcacacttctggcactgcctctgtgacttggacagttgctcacgcatggtgccc
ctgttcagccgctcctacttggctgcgtgggccctatccagcctgcttgtcttcctactc
atggtagctgtctacacacgaattttcttctatgtgcgtagacgggtggaacgcatggcg
gagcacgtcagctgccatccccgctaccgagagaccacactcagcctagtcaagacggtt
gtcatcattctgggggcatttgtggtgtgctggacaccgggccaggtggtgctgctcctg
gatggcctggactgtaagtcctgcaacgttctggctgtggagaagtacttcctgctcctg
gctgaggccaactcactggtcaatgcagtggtatattcctgccgagatgctgagatgcgc
cgcaccttccgccgccttctctgctgcatgtgtctccgctggtccagccacaagtctgcc
cgttactcagcttctgcccagacgggtgccagcacgcggatcatgcttcctgagaatggc
cgcccactgatggactccaccctttaa

KEGG   Mus musculus (mouse): 65086
Entry
65086             CDS       T01002                                 

Gene name
Lpar3, Edg7, L, lpA3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    65086 (Lpar3)
   04072 Phospholipase D signaling pathway
    65086 (Lpar3)
   04151 PI3K-Akt signaling pathway
    65086 (Lpar3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    65086 (Lpar3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    65086 (Lpar3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    65086 (Lpar3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    65086 (Lpar3)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 65086
NCBI-ProteinID: NP_075359
MGI: 1929469
Ensembl: ENSMUSG00000036832
Vega: OTTMUSG00000055329
UniProt: Q9EQ31 Q544B4
Position
3 H2; 3 71.03 cM
AA seq 354 aa
MNECHYDKRMDFFYNRSNTDTADEWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVITNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDTSLTASLANL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLIFWTVSNLLAFFIMVAVYVRIYMYVKRKTNVLSPHTSGSISRRRAPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCKQCNVQHVKRWFLLLALLNSVMNPIIYSYKDEDM
YNTMRKMICCALQDSNTERRPSRNPSTIHSRSETGSQYLEDSISQGPVCNKNGS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaatgagtgtcactatgacaagcgcatggactttttctacaacaggagcaacacagac
acagcggacgagtggacagggacaaagcttgtgatcgtcctgtgcgtggggacgttcttc
tgcctctttatatttttttctaactccctggtcattgctgcggtgatcacaaaccggaag
ttccactttcccttctactacctgctggctaacttagctgctgcggatttcttcgccgga
atcgcttacgtgttcctgatgtttaacactggcccggtgtcgaaaacgttgaccgtcaac
cgctggttcctccgccaggggctcctagacaccagcctgactgcctccctggccaatttg
ctggttattgctgtggaaagacacatgtccatcatgaggatgagagtccacagcaacttg
accaaaaagcgggtgacgctgctcattctgctggtgtgggccatcgccatcttcatgggg
gccgtccccacgctgggatggaattgcctctgcaacatctcggcctgctcttctctggct
cccatttacagtaggagttacctcattttctggactgtgtccaacctcctggccttcttc
atcatggtggcggtatacgtacgcatctacatgtatgttaaaaggaaaaccaacgtctta
tctccacacaccagtggctccatcagccgccggagggctcccatgaagctaatgaagaca
gtgatgaccgtcttaggcgccttcgtggtgtgctggaccccgggtctggtggttctgctg
ctggacggcctgaactgcaagcagtgtaacgtgcaacacgtgaagcgctggttcctgctg
ctcgcactgctcaactccgtcatgaaccccatcatctactcgtacaaggacgaggacatg
tacaacaccatgcggaagatgatctgctgtgccctgcaggacagcaataccgagaggcgc
ccctcccgcaacccctccaccatccacagcaggagcgagacgggcagccagtacctggag
gacagcatcagccagggcccggtgtgcaataaaaacggctcctaa

KEGG   Mus musculus (mouse): 67168
Entry
67168             CDS       T01002                                 

Gene name
Lpar6, 2610302I02Rik, P2r, P2ry5, P2y, P2y5
Definition
(RefSeq) lysophosphatidic acid receptor 6
  KO
K04273  lysophosphatidic acid receptor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    67168 (Lpar6)
   04151 PI3K-Akt signaling pathway
    67168 (Lpar6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    67168 (Lpar6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    67168 (Lpar6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    67168 (Lpar6)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    67168 (Lpar6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 67168
NCBI-ProteinID: NP_780325
MGI: 1914418
Ensembl: ENSMUSG00000033446
Vega: OTTMUSG00000036134
UniProt: Q8BMC0
Position
14; 14 D3
AA seq 344 aa
MVSSNGSQCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCF
CFVPYNINLILYSLMRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDSRFSEVQGTENFIQHNLQTLKNKIFDNESAI
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggtaagctccaatggctcccagtgcccttatgacgactcctttaagtacactctgtac
gggtgcatgttcagcatggtcttcgtgcttgggctgatatccaactgtgttgcgatatac
attttcatctgtgccctcaaagtgagaaatgaaactacaacgtacatgattaacctggca
atgtcagatttacttttcgtctttactttgccatttcggattttttactttgcaacacgg
aattggccatttggagatctactctgtaagatttcagtaatgctgttttacaccaatatg
tatggaagcattctgttcttaacctgtatcagtgtagatcgatttctggcaattgtctac
ccatttaagtcaaagactttaagaacgaaacgaaatgcaaagatcgtttgcattgctgtg
tggttcacagtgatgggaggaagtgcgcctgcagttttctttcagtcgacccactctcag
gggaacaatacctcagaagcctgctttgagaactttccagcggccacatggaaaacttat
ctctccaggattgtgattttcattgaaatagtgggcttttttatccctctcattttgaac
gtaacttgttctagtatggtgctaagaactttaaataaacctgttacattaagtagaagc
aaaatgaacaaaactaaggttttaaaaatgatttttgtccacttggtcatcttctgtttc
tgttttgtgccctacaacatcaacctcattttgtactcgctcatgaggacacagaccttt
gttaactgctctgtggtggcggcagtgaggaccatgtacccgatcactctctgcatcgct
gtttccaactgctgctttgaccctattgtttactacttcacctcagacacaattcagaac
tcaataaaaatgaaaaactggtcggttagaagaagtgactccaggttctctgaagttcag
ggcactgagaattttatccaacacaacctacagaccttaaaaaataagatatttgataat
gaatctgcaatataa

KEGG   Mus musculus (mouse): 78134
Entry
78134             CDS       T01002                                 

Gene name
Lpar4, 5730485F04Rik, Gpr, Gpr23, L, LPA4, p2y, p2y9
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    78134 (Lpar4)
   04072 Phospholipase D signaling pathway
    78134 (Lpar4)
   04151 PI3K-Akt signaling pathway
    78134 (Lpar4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    78134 (Lpar4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    78134 (Lpar4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    78134 (Lpar4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    78134 (Lpar4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    78134 (Lpar4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 78134
NCBI-ProteinID: NP_780480
MGI: 1925384
Ensembl: ENSMUSG00000049929
Vega: OTTMUSG00000018372
UniProt: Q8BLG2
Position
X; X D
AA seq 370 aa
MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS
LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTPKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggtgacagaagatttattgacttccaattccaagatttaaattcaagtctcagaccc
aggttgggaaatgcaactgccaataatacttgcattgttgatgattccttcaagtataat
ttgaatggtgctgtctatagtgttgtattcatcctgggtctaataaccaacagtgcctcc
ctgtttgtcttctgcttccgcatgaaaatgagaagtgagacggctattttcatcaccaac
ctggccctctctgatttgctttttgtttgtaccctacctttcaaaatattttacaacttt
aatcgccactggccttttggtgacaccctctgtaagatctcagggactgcgttcctcacc
aacatctatgggagcatgctcttcctcacctgcatcagtgtggatcgtttcctagccatt
gtctatcccttccgatcgcgtaccatcaggaccaggaggaattccgccattgtgtgcgct
ggagtctggatcctagtcctcagtggtggtatttcagcttctttgttctccaccactaat
gtcaacaatgcgaccaccacttgctttgaaggcttctccaaacgtgtctggaagacatac
ctgtccaagatcactatattcattgaagttgttggattcatcattcctctgatattgaat
gtttcttgttcttctgtggtgcttagaaccctccgcaagcctgcaacattgtctcagatt
gggaccaataaaaaaaaagtgttgaagatgatcacagtgcatatggcagtgtttgtggta
tgctttgtaccatacaactccgttctctttttatatgccttggtacgctcccaagccatt
actaattgcttattggaaaggtttgcaaagatcatgtacccaattaccttgtgccttgca
actctgaattgttgctttgatccttttatctattacttcactcttgaatcctttcagaag
tccttttatatcaatacacatataaggatggagtcgctgtttaagactgagacacctctg
acccccaaaccttcccttccagctatccaagaggaagttagtgatcaaacaacaaataat
ggtggtgaattaatgctggaatccaccttctag

DBGET integrated database retrieval system