KEGG   Mus musculus (mouse): 12671Help
Entry
12671             CDS       T01002                                 

Gene name
Chrm3, Chrm-3, M3, M3R
Definition
(RefSeq) cholinergic receptor, muscarinic 3, cardiac
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04725  Cholinergic synapse
mmu04742  Taste transduction
mmu04810  Regulation of actin cytoskeleton
mmu04911  Insulin secretion
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    12671 (Chrm3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12671 (Chrm3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    12671 (Chrm3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    12671 (Chrm3)
  Digestive system
   04970 Salivary secretion
    12671 (Chrm3)
   04971 Gastric acid secretion
    12671 (Chrm3)
   04972 Pancreatic secretion
    12671 (Chrm3)
  Nervous system
   04725 Cholinergic synapse
    12671 (Chrm3)
  Sensory system
   04742 Taste transduction
    12671 (Chrm3)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    12671 (Chrm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 12671
NCBI-ProteinID: NP_150372
MGI: 88398
Ensembl: ENSMUSG00000046159
Vega: OTTMUSG00000048429
UniProt: Q9ERZ3 Q542R4
Position
13 A1; 13 3.72 cM
AA seq 589 aa AA seqDB search
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVSQLDSYNISQTSGNFSSNDTSSDPLG
GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS
MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT
TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY
MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGTK
RSSRRKYGGCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET
RAIYSIVLKLPGHSTILNSTKLPSSDNLQVPDKDLGTMDVERNAHKLQAQKSMDDRDNCQ
KDFSKLPIQLESAVDTAKTSDTNSSVDKTTAALPLSFKEATLAKRFALKTRSQITKRKRM
SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP
VCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcacagtaacagtacaacctcgcctttgtttcccaacatcagctcttcctgg
gtgcacagtccctcagaggcggggctgcccttggggacagtctctcaattggacagctac
aacatttcccaaacctctgggaatttctcctcaaatgacacctccagtgaccctctaggg
ggccacaccatctggcaagtggtcttcattgcattcttgactggcttcctggcattggtg
accatcatcggcaacatccttgtcattgtggcatttaaggtcaacaaacagctgaagaca
gtcaacaactacttcctcttaagcctggcctgcgcagatctgatcatcggggtcatttcc
atgaacctgttcacgacctacatcattatgaaccgctgggctctggggaacttagcctgt
gacctctggctttccattgactatgtggccagcaatgcttctgtcatgaatctgctggtg
atcagctttgacaggtacttttctattaccaggccactcacttaccgagccaaacgaaca
acaaaacgagccggtgtgatgattggtctggcttgggtcatctcctttgtcctgtgggct
cctgccatcttgttctggcaatactttgtagggaagagaactgtgccccccggagaatgt
ttcattcagtttctaagtgagcccaccatcaccttcggcacggcgatcgctgccttttac
atgcctgtcaccatcatgactattttatactggagaatctataaggagactgagaaacgt
accaaagagctggctgggctacaggcctctgggacagaagcggaagcagaaaactttgtc
caccccacaggcagttctcgaagctgtagcagctatgagctacaacagcaaggcacgaaa
cggtcatctaggaggaagtatggtggctgtcacttctggttcacaactaagagctggaag
cccagtgctgagcagatggaccaagaccacagtagcagtgacagttggaataacaacgat
gctgctgcctccctggaaaactctgcttcttctgatgaagaggatattggctcagagacc
agagccatctattccattgtactcaagctgccgggtcatagcaccatcctcaactctacc
aagctaccctcctcagataacctgcaggtgccagacaaggacctggggactatggatgta
gagagaaatgcccataagcttcaggcccagaagagtatggatgaccgtgacaactgtcag
aaggacttctccaagctccccatccagttagagtctgccgtggacacagccaagacctct
gacaccaactcctcggtggacaagaccacggccgctctacctctgtccttcaaagaagcc
acgctggctaagaggtttgctctcaagaccagaagtcagatcaccaagcggaaaaggatg
tcgctcatcaaggagaagaaggccgcccagacactcagtgccatcttgctggctttcatc
atcacgtggaccccctacaacatcatggtcctggtgaacaccttctgtgacagctgcata
cccaaaacctattggaatctgggctactggctgtgctatatcaacagcaccgtgaacccc
gtgtgctatgccctgtgcaacaagacattcagaaccaccttcaagatgcttctcttatgc
cagtgtgacaagaggaagcggcgcaaacagcagtaccagcagagacagtccgtcattttt
cacaagcgagtgcctgagcaggccttgtag

DBGET integrated database retrieval system