KEGG   Mus musculus (mouse): 12677
Entry
12677             CDS       T01002                                 

Symbol
Vsx2, Chx10, Hox-1, Hox-10, Hox1, Hox10, or
Name
(RefSeq) visual system homeobox 2
  KO
K09336  visual system homeobox protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12677 (Vsx2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    12677 (Vsx2)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN
Other DBs
NCBI-GeneID: 12677
NCBI-ProteinID: NP_031727
MGI: 88401
Ensembl: ENSMUSG00000021239
Vega: OTTMUSG00000038498
UniProt: Q61412 Q80WF9
Position
12 D1; 12 39.28 cM
AA seq 361 aa
MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGH
LLAARSVLSPAGVGSMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQT
ASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREM
LAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSA
KDGIMDSCAPWLLGMHKKSLEAAAESGRKPEVERQALPKLDKMEQEERAPEAQAAISQEE
LRENSIAALRAKAQEHSTKVLGTVSGPDSLARNAEKPEEEDATEEDRPAEKLSPPQLEDM
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgacggggaaagcgggggaagcgctgagcaagcccaaatccgagacagtggccaagagt
acctcggggggcgccccggccaggtgcacagggttcggcatccaggagatcctaggcttg
aacaaggagcctcccagctcccacccgcgggctgccctcgacggcctggcccctgggcat
ttgttagctgcgcgctccgttctcagcccggcaggagtgggcagcatggggctgctgggg
cccgggggacttcccggcttctacacacagcccaccttcttggaagtgctgtccgatccg
cagagcgtccacttgcagccactaggcagagcgtcggggccgctggacaccagccagacg
gccagctccgattccgaagatgtttcctccagtgaccgaaaaatgtccaaatcggcttta
aaccagaccaagaagcgtaagaagcggcgacacaggacaatctttacttcctaccagcta
gaggagctggagaaagcattcaatgaagcccactacccagatgtctacgcccgggagatg
ctggccatgaaaacggagctcccagaagacaggatacaggtgtggttccagaaccgcaga
gccaagtggaggaagagggagaagtgctggggccggagcagcgtcatggctgagtatggt
ctctatggagccatggtgaggcactcgatccccctgccagagtctatcctcaagtctgcc
aaggatggcataatggattcctgtgccccatggctactggggatgcacaaaaagtcgctg
gaggcagcagctgagtcgggaaggaagcccgaggtggaacgccaggccctgcccaagctc
gacaagatggagcaggaggaacgggccccagaggcccaggcagccatctcccaggaagaa
ctgagggagaacagcattgccgccctccgagccaaagctcaggaacacagcaccaaggtt
ctggggactgtatctgggcctgacagcctggccagaaatgctgagaagccagaagaagag
gacgccacggaggaagacaggccagctgagaagctcagcccaccgcagctggaggacatg
gcttag

DBGET integrated database retrieval system