KEGG   Mus musculus (mouse): 12683
Entry
12683             CDS       T01002                                 

Gene name
Cidea, AW212747
Definition
(RefSeq) cell death-inducing DNA fragmentation factor, alpha subunit-like effector A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CIDE-N
Other DBs
NCBI-GeneID: 12683
NCBI-ProteinID: NP_031728
MGI: 1270845
Ensembl: ENSMUSG00000024526
UniProt: O70302
Position
18; 18 E1
AA seq 217 aa
METARDYAGALIRPLTFMGLQTKKVLLTPLIHPARPFRVSNHDRSSRRGVMASSLQELIS
KTLDVLVITTGLVTLVLEEDGTVVDTEEFFQTLRDNTHFMILEKGQKWTPGSKYVPVCKQ
PKKSGIARVTFDLYRLNPKDFLGCLNVKATMYEMYSVSYDIRCTSFKAVLRNLLRFMSYA
AQMTGQFLVYAGTYMLRVLGDTEEQPSPKPSTKGWFM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggagaccgccagggactacgcgggagccctcatcaggcccctgacattcatgggattg
cagactaagaaggtcctactgacccccctcatacatccagctcgcccttttcgagtttca
aaccatgaccgaagtagccggcgtggggtgatggccagcagcctgcaggaacttatcagc
aagactctggatgtcttagtcatcacaactggcctggttacgctggtgctggaggaggac
ggcaccgtggtggacacagaggagttctttcagaccttaagggacaacacgcatttcatg
atcttggaaaagggacagaaatggacaccgggtagtaagtatgtcccagtctgcaagcaa
ccaaagaaatcgggaatagccagagtcaccttcgacctatacaggctgaaccccaaggac
ttcctcggctgtctcaatgtcaaagccacgatgtacgagatgtactcggtgtcctacgac
atccgatgcacaagcttcaaggccgtgttaaggaatctgctgaggtttatgtcctatgct
gcacagatgacgggacagttcctggtctatgcgggcacatacatgctccgagtactgggc
gatacagaagagcagccatcccccaagcctagcaccaaaggctggttcatgtaa

DBGET integrated database retrieval system