KEGG   Mus musculus (house mouse): 12683
Entry
12683             CDS       T01002                                 
Symbol
Cidea
Name
(RefSeq) cell death-inducing DNA fragmentation factor, alpha subunit-like effector A
  KO
K25893  cell death activator CIDE-A
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    12683 (Cidea)
SSDB
Motif
Pfam: CIDE-N
Other DBs
NCBI-GeneID: 12683
NCBI-ProteinID: NP_031728
MGI: 1270845
Ensembl: ENSMUSG00000024526
UniProt: O70302
Position
18:67476634..67500864
AA seq 217 aa
METARDYAGALIRPLTFMGLQTKKVLLTPLIHPARPFRVSNHDRSSRRGVMASSLQELIS
KTLDVLVITTGLVTLVLEEDGTVVDTEEFFQTLRDNTHFMILEKGQKWTPGSKYVPVCKQ
PKKSGIARVTFDLYRLNPKDFLGCLNVKATMYEMYSVSYDIRCTSFKAVLRNLLRFMSYA
AQMTGQFLVYAGTYMLRVLGDTEEQPSPKPSTKGWFM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggagaccgccagggactacgcgggagccctcatcaggcccctgacattcatgggattg
cagactaagaaggtcctactgacccccctcatacatccagctcgcccttttcgagtttca
aaccatgaccgaagtagccggcgtggggtgatggccagcagcctgcaggaacttatcagc
aagactctggatgtcttagtcatcacaactggcctggttacgctggtgctggaggaggac
ggcaccgtggtggacacagaggagttctttcagaccttaagggacaacacgcatttcatg
atcttggaaaagggacagaaatggacaccgggtagtaagtatgtcccagtctgcaagcaa
ccaaagaaatcgggaatagccagagtcaccttcgacctatacaggctgaaccccaaggac
ttcctcggctgtctcaatgtcaaagccacgatgtacgagatgtactcggtgtcctacgac
atccgatgcacaagcttcaaggccgtgttaaggaatctgctgaggtttatgtcctatgct
gcacagatgacgggacagttcctggtctatgcgggcacatacatgctccgagtactgggc
gatacagaagagcagccatcccccaagcctagcaccaaaggctggttcatgtaa

DBGET integrated database retrieval system