KEGG   Mus musculus (house mouse): 12695
Entry
12695             CDS       T01002                                 
Symbol
Patj, Cipp, Inadl
Name
(RefSeq) PATJ, crumbs cell polarity complex component
  KO
K06092  InaD-like protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    12695 (Patj)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12695 (Patj)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12695 (Patj)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Peptidase_M50 L27_2
Other DBs
NCBI-GeneID: 12695
NCBI-ProteinID: NP_766284
MGI: 1277960
Ensembl: ENSMUSG00000061859
UniProt: Q63ZW7 A2ADL9
Position
4:98283803..98607840
AA seq 1834 aa
MPENPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQL
KGQLSHIPSDCSANFDFSRKGLLVFTDGSITNGNAQRPCSNVTASELLPWTQKSASEDFN
SVIQQMAQGRHVEYIDIERPSTGGLGFSVVALRSQSLGLIDIFVKEVHPGSVADRDHRLK
ENDQILAINDTPLDQNISHQQAIALLQQATGSLRLVVAREVGHTQGRASTSSADTTLPET
VCWGHTEEVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPVGEIAVTPPTPVSLPVALPAVATRTLDSDRSP
FETYSVELVKKDGQSLGIRIVGYVGTAHPGEASGIYVKSIIPGSAAYHNGQIQVNDKIVA
VDGVNIQGFANQDVVEVLRNAGQVVHLTLVRRKTSLSASPFEHSSSRETVAEPPKVPERA
GSPKPEANLSVEAEEIGERLDNLKNNTVQALEKPDVYPEKVPGSPENELKSRWENLLGPD
YEVMVATLDAQIADDEELQKYSKLLPIHTLRLGMEVDSFDGHHYISSVAPGGPVDTLNLL
QPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRTMEPALLE
AEVDHSVDVNIEDDDDGELALWSPEVKTVELVKDCKGLGFSILDYQDPLDPTRSVIVIRS
LVADGVAERSGELLPGDRLVSVNEFSLDNATLAEAVEVLKAVPPGVVHLGICKPLVEDEK
EERFSLHSNNNGDSSEPADAVHEIHSSLILEAPQGFRDEPYLEELVDEPFLDLGKSLQFQ
QKDVDSSSEAWEMHEFLSPPLDGRGEEREMLVDEEYELYQDHLRAMESNPPPPHIREAAP
ASPVLELQAGTQWLHANLSGGERLECHDAESMMSAYPQEMQQYSYSTADMMEETFGLDSR
APIPSSEGNGQHGRFDDMGHLHSLTSSSLDLGMMIPSDLQGPGVLVDLPAVAQRREQEDL
PLYRLPSARVVTKPSSHMGLVSSRHANAACELPEREEGEGEETPNFSHWGPPRIVEIFRE
PNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQ
NASHAEAVEAIKSAGNPVVFVVQSLSSTPRVIPTVNNKGKTPAPNQDQNTQERKAKRHGT
APPPMKLPPPYRAPSADMEGSEEDCALTDKKIRQRYADLPGELHIIELEKDKNGLGLSLA
GNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPTRV
KLVFIRNEDAVSQMAVAPFPELSHSPSPVEDLGGTELVSSEEESSVDAKHLPEPESSKPE
DLSQVVDDNMVAEQQKESESPDSAACQIKQQTYSTQVSSSSQDSPSSPAPLCQSAHADVT
GSGNFQAPLPVDPAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLDAIVIH
EVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVVYRDEAQYRD
EENLEVFLVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNG
EDMRHASQETVATILKCVQGLVQLEIGRLRAGSWAASRKTSQNSQGDQHSAHSSCRPSFA
PVITSLQNLVGTKRSSDPPQKCTEEEPRTVEIIRELSDALGISIAGGKGSPLGDIPIFIA
MIQANGVAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKNAFGRIILQVVADTNISAI
ATQLEIMSAGSQLGSPTADRHPEDTEEQMQRTAD
NT seq 5505 nt   +upstreamnt  +downstreamnt
atgcctgaaaaccctgctgcagagaagatgcaggtcctgcaggtcctggatcgccttcga
gggaagctgcaggagaagggagacacgacgcagaacgagaagctgtctgcgttctacgag
acgctgaagagccctctcttcaaccagatccttacactgcagcagtccatcaagcagctg
aagggacagcttagccacatcccctcagattgctcagccaactttgacttttctcgcaag
ggcttgctagtgttcacggatggttccattacaaacgggaatgcccaaaggccttgtagt
aatgtgactgcatctgaactgttgccctggactcaaaagtcagcaagtgaagactttaac
tcagtcattcagcagatggctcagggccggcacgttgagtatatagatattgaacgtcct
tcaactggaggccttggattcagtgtggtggctctgagaagccaaagcctgggattaatt
gatatctttgtgaaggaagtccatcccgggagtgtagcagacagggatcacagattgaag
gaaaatgaccagattttggccattaatgacaccccattggatcagaatatttcccatcag
caggcgattgcattactacaacaagccactggatctctgcggctggttgtggccagggaa
gtgggccacacacagggccgagcatccaccagctcagctgatacaactctgccagaaacg
gtgtgttggggccacacggaagaggttgagctcattaacgatggctctggattaggtttt
gggatagttggagggaaatccagcggcgtggtcgtgaggactattgttcctggaggactg
gcagaccgagatggaagactgcagacaggggatcacatcttgaagattggtggtacaaat
gttcaagggatgaccagtgaacaagttgctcaagtgctaaggaactgtgggaattcagtg
aggatgctggtggccagagaccctgttggtgaaattgcagtaacacctcctacccctgta
tccttacctgttgccctacctgctgtagccacaaggacccttgattctgacaggtctcct
tttgaaacttacagtgttgaacttgttaagaaagatgggcagagtcttgggattagaatt
gttggctatgttggaacagctcatccaggggaagcttccgggatttatgtgaaaagtata
attccaggcagcgctgcataccacaatggccaaattcaagtgaatgataaaatcgtggct
gtggatggtgtgaatattcaaggttttgctaatcaggatgttgtcgaagtattgcggaat
gctgggcaggtggtacacctgacccttgttcgaaggaaaacatctttatctgcttctccg
tttgagcactcttcaagcagagaaactgttgcagaaccacctaaagtaccagaacgagca
ggatccccgaaaccagaagctaatttgagtgtggaagcagaggaaattggagaaagactg
gataatctaaaaaacaacactgtacaagccttagaaaaaccagatgtatatccagagaaa
gttccaggctctccagaaaatgagctgaaatccagatgggaaaacctactgggcccagat
tatgaagtaatggtagccactttggatgctcagattgcagacgatgaggagctacagaaa
tactcgaagctgctgcctatccacacgctcaggcttgggatggaagtcgactccttcgat
gggcaccactatatctcctcagttgctcctgggggtcctgtggataccctgaacctcctt
cagccagaggatgaacttcttgaggtcaacggcatgcagctttatgggaagtctcgccga
gaagcagtctccttccttaaagaagtgcccccaccatttaccttggtctgctgccgccgg
ctgtttgatgatgaggcctcagttgatgagccaagaaccatggagcctgctcttcttgag
gccgaggttgaccacagtgtagatgtcaacattgaagatgatgatgatggagaattagcc
ctgtggtctcctgaagtcaagactgtggagctggtgaaagactgcaaaggcttaggattc
agtattttggattatcaggaccccctggatcccacgcggtcagtgattgtgattcgctcc
ttggtggcagatggtgtagcggaaagaagtggagaacttttacctggagatcgcctagtc
tccgtcaatgagttctccttggacaatgccactcttgctgaggctgtggaagtgttgaag
gctgtacccccaggtgtggtgcatcttggcatctgtaagcctttggtggaagatgagaag
gaagagcgttttagtttacattcaaacaacaatggtgacagcagcgagcctgcagacgct
gttcatgagatccactcatctttaatccttgaggcaccccagggatttagagatgagcca
tatcttgaagaactcgtggatgaaccttttctagatttgggaaagtctttgcagttccaa
caaaaagacgtggacagcagctcggaagcttgggaaatgcatgagttcctgagtcctccg
ctggacggcaggggtgaggagagagagatgcttgtcgatgaggagtatgaactttatcaa
gatcacctccgggccatggagtcaaacccaccaccaccacacattcgggaggccgctcct
gcatctcccgtgctggaactccaggctggtacacagtggctgcatgctaacctctcagga
ggcgaaaggctggagtgtcacgatgcagagtccatgatgagtgcctatccccaggagatg
cagcagtatagctacagcactgcagacatgatggaagaaacgtttggccttgattcccgg
gcccccataccgtcctctgaaggaaatggtcaacacggcagatttgatgacatgggacac
cttcattcactaacgagcagcagcctggatttaggcatgatgattccaagtgatctgcaa
ggtcctggcgtgcttgtcgatcttccagctgttgctcaaagaagagaacaggaagatttg
cctctgtaccgactccccagcgcccgcgttgtcaccaagccgtcatcacacatgggactg
gtgtcttcacggcatgcaaatgctgcatgtgaattaccggagagagaggaaggtgaagga
gaggagacaccgaacttcagccactggggtccaccaagaatagttgaaatttttagagaa
cctaatgtgtctcttggcatcagcatcgttggtggacaaacagttataaaacgcctcaag
aatggagaggaactcaaggggatattcatcaaacaagtgttagaggacagtcctgccggg
aagaccaatgcgctgaaaaccggagataaaattcttgaggtgtctggtgtagacctgcag
aatgcctcccatgcagaagccgtggaggcaatcaagagtgcgggaaaccctgtggtattc
gtggtacagagcctgtcatccaccccaagggtcatcccaactgtgaataacaaaggcaaa
acacctgccccgaaccaggatcaaaacactcaagaaaggaaagctaagaggcacggaaca
gctccacctccaatgaagctgcccccgccctacagagctccatctgcagacatggaggga
agtgaagaagactgtgcgctgaccgacaaaaagatcaggcaaagatatgcagacctgccg
ggagaactacacattatcgaactggaaaaggacaagaatggactggggctcagtctcgct
ggcaataaggacaggtcacggatgagcatcttcgtggtggggattaatccggagggacct
gctgctgcagacggacggatgcggattggagacgagctgctagagataaacaatcagatt
ctttatggaagaagtcatcagaacgcatctgccattattaagactgccccaaccagggtc
aaactggttttcattagaaacgaagatgcagtcagtcagatggccgtcgctcccttcccg
gagctatcacattctccatcgcctgttgaggatctgggtggcactgaacttgtcagtagt
gaagaggagagcagtgtggatgctaaacacctgcctgaaccagaaagctccaaaccggaa
gacctgtcccaggtggttgatgacaacatggtggcagagcagcagaaggaatcggagtca
cctgacagtgctgcctgccagataaaacagcagacatattcaacacaagtctcctccagc
tcgcaagatagcccatcgtcaccggctccattgtgtcagtcagcacatgcagacgtcaca
ggctctggtaacttccaggctcctctcccagtggaccctgctccactctcggtggaccct
gcaacatgtcccatcgtccctggccaggaaatgatcatagaaatatccaagggacgctcc
gggctcgggctcagcattgttggaggaaaagacacacctttggatgctatagttatccat
gaagtctatgaagaaggtgcagctgccagagatggaagattatgggctggagaccagata
ttagaggttaatggggttgatctgcggagctccagccatgaagaagccatcacagccctg
aggcagaccccccagaaggtgcggctggtggtatacagagatgaagcacagtacagagac
gaggagaacttggaggtgttccttgtggacctgcagaagaagactggccgaggactaggc
ctgagcattgttgggaaacggagtggaagtggagtgtttatttctgacattgtgaaaggc
ggggccgcagacctcgatgggaggttaattcgaggagaccagatcttgtctgtgaatgga
gaggacatgagacacgcctcacaggagacagtggccaccatcctgaagtgtgtccagggc
cttgtccagctggagattgggagactccgcgccggttcctgggccgcctctcggaagacc
tcgcagaacagccagggggatcagcacagtgcgcacagcagctgtcggccttcctttgcc
ccagtcatcaccagcctacaaaacctggttggcacaaaaagatcttcagatcctccacag
aaatgcacagaggaggaaccaaggactgtagagataatcagagagctcagcgatgccctt
gggatcagtatcgctggaggaaaagggagtcctttaggagatatccccatatttattgcc
atgattcaggccaacggagtggccgcacggacccagaagcttaaggttggagatcggatt
gtgagcattaatggacaacctctggatggactgtctcacacagatgccgttaatctactg
aagaatgccttcgggcgcattatcctgcaggttgtggcagataccaacataagtgccata
gcgacccagctggaaatcatgtctgcaggctcccagcttggctctccgactgctgaccga
catccggaagacacagaggagcagatgcagaggacggctgattaa

DBGET integrated database retrieval system