KEGG   Mus musculus (mouse): 12700
Entry
12700             CDS       T01002                                 

Gene name
Cish, C, CI, CIS-1, CIS1, Cis, F17, F23, SOCS
Definition
(RefSeq) cytokine inducible SH2-containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12700 (Cish)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    12700 (Cish)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    12700 (Cish)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    12700 (Cish)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     12700 (Cish)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   12700 (Cish)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 12700
NCBI-ProteinID: NP_034025
MGI: 103159
Ensembl: ENSMUSG00000032578
Vega: OTTMUSG00000036835
UniProt: Q62225 Q8C3F4
Position
9 F1; 9 57.99 cM
AA seq 257 aa
MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQAENEPKV
LDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAP
TPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCL
PLPRRMADYLRQYPFQL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggtcctttgcgtacagggatcttgtcctttgctggctgtggagcaaattgggcggcgg
cctctgtgggcccagtccctggagctgcccgggccagccatgcagcccttacccactggg
gcattcccagaggaagtgacagaggagacccctgtccaggcagagaatgaaccgaaggtg
ctagaccctgagggggatctgctgtgcatagccaagacgttctcctaccttcgggaatct
gggtggtactggggttctattacagccagcgaggcccggcagcacctacagaagatgccg
gagggtacattcctagttcgagacagcacccaccccagctacctgttcacactgtcagtc
aaaaccacccgtggccccaccaacgtgcggatcgagtacgccgattctagcttccggctg
gactctaactgcttgtcaagacctcgaatcctggccttcccagatgtggtcagccttgtg
cagcactatgtggcctcctgtgcagctgacacccggagcgacagcccggatcctgctccc
accccagccctgcctatgtctaagcaagatgcacctagtgactcggtgctgcctatcccc
gtggctactgcagtgcacctgaaactggtgcagccctttgtgcgcaggagcagcgcccgc
agcttacaacatctgtgtcggctagtcatcaaccgtctggtggccgacgtggactgccta
cccctgccccggcgtatggccgactacctccgacagtaccccttccaactctga

DBGET integrated database retrieval system