KEGG   Mus musculus (mouse): 12702
Entry
12702             CDS       T01002                                 

Gene name
Socs3, Cis3, Cish3, EF-10, Ef10, SSI-3, Ssi3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04380  Osteoclast differentiation
mmu04630  JAK-STAT signaling pathway
mmu04668  TNF signaling pathway
mmu04910  Insulin signaling pathway
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04935  Growth hormone synthesis, secretion and action
mmu05160  Hepatitis C
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12702 (Socs3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12702 (Socs3)
   04668 TNF signaling pathway
    12702 (Socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    12702 (Socs3)
   04920 Adipocytokine signaling pathway
    12702 (Socs3)
   04917 Prolactin signaling pathway
    12702 (Socs3)
   04935 Growth hormone synthesis, secretion and action
    12702 (Socs3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12702 (Socs3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12702 (Socs3)
   04932 Non-alcoholic fatty liver disease
    12702 (Socs3)
   04931 Insulin resistance
    12702 (Socs3)
  09172 Infectious disease: viral
   05164 Influenza A
    12702 (Socs3)
   05160 Hepatitis C
    12702 (Socs3)
   05168 Herpes simplex virus 1 infection
    12702 (Socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    12702 (Socs3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     12702 (Socs3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 12702
NCBI-ProteinID: NP_031733
MGI: 1201791
Ensembl: ENSMUSG00000053113
Vega: OTTMUSG00000003735
UniProt: O35718
Structure
PDB: 
2HMH 4GL9 2JZ3 2BBU

Position
11; 11 E2
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaaaagcgagtaccagctggtggtgaacgccgtgcgcaag
ctgcaggagagcggattctactggagcgccgtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgcgggcacctttcttatccgcgacagctcggaccagcgccacttcttc
acgttgagcgtcaagacccagtcggggaccaagaacctacgcatccagtgtgaggggggc
agcttttcgctgcagagtgacccccgaagcacgcagccagttccccgcttcgactgtgta
ctcaagctggtgcaccactacatgccgcctccagggaccccctccttttctttgccaccc
acggaaccctcgtccgaagttccggagcagccacctgcccaggcactccccgggagtacc
cccaagagagcttactacatctattctgggggcgagaagattccgctggtactgagccga
cctctctcctccaacgtggccaccctccagcatctttgtcggaagactgtcaacggccac
ctggactcctatgagaaagtgacccagctgcctggacccattcgggagttcctggatcag
tatgatgctccactttaa

DBGET integrated database retrieval system