KEGG   Mus musculus (mouse): 12702
Entry
12702             CDS       T01002                                 

Gene name
Socs3, CI, Cis, Cis3, Cish3, EF-10, Ef10, SOC, SS, SSI-3, Ssi3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04380  Osteoclast differentiation
mmu04630  JAK-STAT signaling pathway
mmu04668  TNF signaling pathway
mmu04910  Insulin signaling pathway
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04935  Growth hormone synthesis, secretion and action
mmu05160  Hepatitis C
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12702 (Socs3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12702 (Socs3)
   04668 TNF signaling pathway
    12702 (Socs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    12702 (Socs3)
   04920 Adipocytokine signaling pathway
    12702 (Socs3)
   04917 Prolactin signaling pathway
    12702 (Socs3)
   04935 Growth hormone synthesis, secretion and action
    12702 (Socs3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12702 (Socs3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    12702 (Socs3)
   05164 Influenza A
    12702 (Socs3)
   05168 Herpes simplex virus 1 infection
    12702 (Socs3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12702 (Socs3)
   04932 Non-alcoholic fatty liver disease
    12702 (Socs3)
   04931 Insulin resistance
    12702 (Socs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    12702 (Socs3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     12702 (Socs3)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 12702
NCBI-ProteinID: NP_031733
MGI: 1201791
Ensembl: ENSMUSG00000053113
Vega: OTTMUSG00000003735
UniProt: O35718
Structure
PDB: 
2HMH 4GL9 2JZ3 2BBU

Position
11; 11 E2
AA seq 225 aa
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt   +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaaaagcgagtaccagctggtggtgaacgccgtgcgcaag
ctgcaggagagcggattctactggagcgccgtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgcgggcacctttcttatccgcgacagctcggaccagcgccacttcttc
acgttgagcgtcaagacccagtcggggaccaagaacctacgcatccagtgtgaggggggc
agcttttcgctgcagagtgacccccgaagcacgcagccagttccccgcttcgactgtgta
ctcaagctggtgcaccactacatgccgcctccagggaccccctccttttctttgccaccc
acggaaccctcgtccgaagttccggagcagccacctgcccaggcactccccgggagtacc
cccaagagagcttactacatctattctgggggcgagaagattccgctggtactgagccga
cctctctcctccaacgtggccaccctccagcatctttgtcggaagactgtcaacggccac
ctggactcctatgagaaagtgacccagctgcctggacccattcgggagttcctggatcag
tatgatgctccactttaa

KEGG   Mus musculus (mouse): 12703
Entry
12703             CDS       T01002                                 

Gene name
Socs1, Cis, Cish1, Cish7, JA, JAB, SOC, SOCS-1, SS, SSI-1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04380  Osteoclast differentiation
mmu04630  JAK-STAT signaling pathway
mmu04910  Insulin signaling pathway
mmu04917  Prolactin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04935  Growth hormone synthesis, secretion and action
mmu05145  Toxoplasmosis
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12703 (Socs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12703 (Socs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    12703 (Socs1)
   04917 Prolactin signaling pathway
    12703 (Socs1)
   04935 Growth hormone synthesis, secretion and action
    12703 (Socs1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12703 (Socs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12703 (Socs1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    12703 (Socs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12703 (Socs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    12703 (Socs1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     12703 (Socs1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 12703
NCBI-ProteinID: NP_001258532
MGI: 1354910
Ensembl: ENSMUSG00000038037
UniProt: O35716
Position
16 A1; 16 5.81 cM
AA seq 212 aa
MVARNQVAADNAISPAAEPRRRSEPSSSSSSSSPAAPVRPRPCPAVPAPAPGDTHFRTFR
SHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKM
ASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCR
QRIVAAVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 639 nt   +upstreamnt  +downstreamnt
atggtagcacgcaaccaggtggcagccgacaatgcgatctccccggcagcagagccccga
cggcggtcagagccctcctcgtcctcgtcttcgtcctcgccagcggcccccgtgcgtccc
cggccctgcccggcggtcccagccccagcccctggcgacactcacttccgcaccttccgc
tcccactccgattaccggcgcatcacgcggaccagcgcgctcctggacgcctgcggcttc
tattggggacccctgagcgtgcacggggcgcacgagcggctgcgtgccgagcccgtgggc
accttcttggtgcgcgacagtcgccaacggaactgcttcttcgcgctcagcgtgaagatg
gcttcgggccccacgagcatccgcgtgcacttccaggccggccgcttccacttggacggc
agccgcgagaccttcgactgccttttcgagctgctggagcactacgtggcggcgccgcgc
cgcatgttgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgtcgc
cagcgcatcgtggccgccgtgggtcgcgagaacctggcgcgcatccctcttaacccggta
ctccgtgactacctgagttccttccccttccagatctga

KEGG   Mus musculus (mouse): 192157
Entry
192157            CDS       T01002                                 

Gene name
Socs7, 2310063P06Rik, C85125, N, Nap4
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    192157 (Socs7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    192157 (Socs7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    192157 (Socs7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     192157 (Socs7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 192157
NCBI-ProteinID: NP_619598
MGI: 2651588
Ensembl: ENSMUSG00000038485
Vega: OTTMUSG00000002672
UniProt: Q8VHQ2
Position
11; 11 D
AA seq 648 aa
MQGAELRDGEAAAAAASYRVLSRLLGYGEAAPEPGPPPPPPPPGHSHGPSPPPPFLARPG
SRGARPPQLMVFRNVGRPPEEEDAEAAREPGPSELLCPRHRCALDPKALPPGLALERTWG
PVAGLEAQLAALGLGQPAGPGIKTAGGGCCPCPCPPQPPPPQPPPPAAAPQAGEDPTETS
DALLVLEGLESEAESLETNSCSEEELSSPGRGGGGVGGRLLLQPPGPELPPVPFPLQDLV
PPGRLSRGEQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGT
GKRPSGDLAASAASLTDMGGSAVRELDTGRKPRLTRTQSAFSPVSFSPLFTGETVSLVDV
DISQRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAP
DAFPRIAPIRASESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMK
LKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVE
FIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRID
HIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgcagggggccgagctccgggacggcgaggcggcggcggcggccgcttcgtaccgggtc
ctgagccgcctcctcggctatggagaggccgcccccgagccaggcccgccgccgccgccg
ccgcccccgggccacagccatggcccgtcgccgccaccacccttcctcgcgcggcccggc
tcgcggggcgcccggccgcctcagctgatggtgttccgcaacgtggggcggccgccggag
gaggaggacgcggaggcggcccgggagccgggaccctcggaactgctgtgtccccggcac
cgctgcgcgctggatcccaaggccctcccgccgggcttggcgctcgagcggacctggggt
cccgtggctggactagaggcgcagctggcggccctggggctcggacagccggcggggccg
gggatcaagactgccggcggaggctgctgtccgtgcccgtgtcccccgcagccgccgccg
ccgcaacccccgccgcctgctgccgccccgcaggccggggaggacccgacggagacgagc
gacgcgctgctggtcctggagggcttggaatcggaggccgagagcctggagactaacagc
tgctcggaagaggagctcagcagccccggccgtggaggaggaggagtgggtggccggctg
cttctgcagcctccgggtcccgaactacccccggtgccctttccgctgcaggacttggtc
cctccagggcgcttgagccgaggggagcagcagcagcagcaacctcccccaccgccgccg
cctcccgggcccctccggcctctcgcaggcccttctcggaagggctccttcaaaatccgc
ctcagtcgcctgtttcgcacgaagagctgtaacggcggctcgggcggcggggatgggacc
ggcaagaggccttcgggagatctggcagcttcagctgcgagcctgaccgacatgggaggc
tcagcggtccgggagctggatacggggaggaaacccaggttgacaagaactcaaagtgcc
ttttccccggtctccttcagccccctgttcacaggtgagacagtatcgcttgtggacgtg
gacatttctcagcggggcctgacctctccacaccctccaactccccctcctcctccaaga
agaagcctcagcctcctagatgatatcagtgggacgctgcctacatctgtccttgtggct
ccgatggggtcttccttgcagtctttccccctacctccgcctcctccaccccacgcccca
gatgcgtttccccgaattgctcccatcagagcgtcagaatccctgcacagccagccccct
cagcacctccagtgtcccctctatcggcccgactcaagcagctttgcagccagccttcga
gagctggaaaagtgcggctggtactggggacctatgaattgggaagatgcagagatgaaa
ctgaaggggaagccagatggttctttcctggtacgagacagctctgatcctcgttacatc
ctgagcctcagctttcgatcacagggtatcacccatcacactagaatggagcactataga
gggactttcagcttatggtgccatcccaagtttgaggatcgctgtcagtcggtggtggag
ttcattaagagagccatcatgcactccaagaacgggaaatttctctatttcctgagatcc
agggtcccaggactgccaccaactccagtacagctgctctatccagtgtccagattcagc
aatgtcaagtccctccagcatctttgcagattccggatccggcagcttgtccgaatagac
catattccggatctgccactgcctaaacctctgatctcttacattcgaaagttctactac
tatgatcctcaggaagaggtgtacctgtccctaaaggaagcgcagctcatttccaaacag
aaacaagaggtggagccttccacgtag

KEGG   Mus musculus (mouse): 216233
Entry
216233            CDS       T01002                                 

Gene name
Socs2, 8030460M17, AI527257, AW108012, CI, CIS2, Cis, Cish2, D130043N08Rik, JA, JAB, SOC, SOCS-2, SS, SSI-2, hg
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
mmu04910  Insulin signaling pathway
mmu04917  Prolactin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    216233 (Socs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    216233 (Socs2)
   04917 Prolactin signaling pathway
    216233 (Socs2)
   04935 Growth hormone synthesis, secretion and action
    216233 (Socs2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    216233 (Socs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    216233 (Socs2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     216233 (Socs2)
SSDB
Motif
Pfam: SH2 SOCS_box SH2_2 Condensation
Other DBs
NCBI-GeneID: 216233
NCBI-ProteinID: NP_001162126
MGI: 1201787
Ensembl: ENSMUSG00000020027
Vega: OTTMUSG00000028424
UniProt: O35717 Q548Q7
Position
10 C2; 10 49.35 cM
AA seq 198 aa
MTLRCLEPSGNGADRTRSQWGTAGLPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctggagccctccgggaatggagcggacaggacgcggagccagtgg
gggaccgcggggttgccggaggaacagtcccccgaggcggcgcgtctggcgaaagccctg
cgcgagctcagtcaaacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggctccagaaggaactttcttgattagagatagttcgcattcagactac
ctactaactatatccgttaagacgtcagctggaccgactaacctgcggattgagtaccaa
gatgggaaattcagattggattctatcatatgtgtcaagtccaagcttaaacagtttgac
agtgtggttcatctgattgactactatgtccagatgtgcaaggataaacggacaggccca
gaagccccacggaatgggactgttcacctgtacctgaccaaacctctgtatacatcagca
cccactctgcagcatttctgtcgactcgccattaacaaatgtaccggtacgatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Mus musculus (mouse): 54607
Entry
54607             CDS       T01002                                 

Gene name
Socs6, 1500012M23Rik, 5830401B18Rik, AI447482, CI, Cis, Cis4, Cish4, HSPC0, HSPC060, S, SOC, SOCS-4, SOCS-6, SSI4, ST, STA, STAI4, STATI4, So, Socs4
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    54607 (Socs6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    54607 (Socs6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    54607 (Socs6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     54607 (Socs6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 54607
NCBI-ProteinID: NP_061291
MGI: 1924885
Ensembl: ENSMUSG00000056153
Vega: OTTMUSG00000033185
UniProt: Q9JLY0
Position
18; 18 E4
AA seq 533 aa
MKKISLKTFRKSFNLSKSKDETEFMVVQPQSLAGDFVKDDSLFGSCYGKDMASCDIGSED
EKGKNRSKSESLMGTLKRRLSAKQKTKGKGGTASTDEDTFSSASAPGGLKDVRAPRPIRS
TSLRSHHYSPTPWPLRPTSSEETCIKMEMRVKALVHAASPGPVNGVRKDLRELQPRELRD
LQPEPRPESRCSPSSPGDLSLHLEEHVPVVIGLMSQDYLQYTVPLDDGMCPLEGPRSCCL
DTSSPMEVSAVPLPGASGAFSEDDSHVDQDLVVGPEILVDSSVNNLLIGTTGVMLQSPRG
GHDDAPPLSPLLPPMQNNPIQRNFSGLSGPDLHMAESVRCHLNFDPNSAPGVARVYDSVQ
SSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSF
RSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSAT
YPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgaagaaaatcagtctgaagaccttcaggaaatcttttaacctgagtaaaagcaaagac
gaaactgagttcatggtggttcagccccagtcccttgctggtgacttcgtgaaagatgac
tctttattcgggagctgttatggcaaagacatggccagttgtgacattggcagcgaggat
gagaaagggaagaacagatccaaaagcgagagcctgatgggcactttgaagaggcggttg
tccgccaagcagaagaccaagggcaagggcggcactgcgtctacagatgaggacaccttc
tcctcagcttcagctcctggtgggctcaaggatgtgcgtgctccgcggcccatccgctcc
acatcactgagaagccaccattatagccccacgccctggccgctgcgtcccaccagctcg
gaggagacgtgcatcaagatggagatgcgagtgaaagcactggtgcatgctgccagccca
ggaccagtcaacggtgtgcgcaaggatctgcgggagctacagcccagggagctgcgagac
ctgcagccagagccgcgccctgagtcccgctgcagccccagctcacccggggacctgagc
ctccacctggaggaacacgtgcctgtagtaatcggactcatgtctcaggactaccttcag
tacaccgtgcctttagatgacgggatgtgccctcttgaagggccgcgcagctgctgcctg
gatacgtcttctcccatggaggtgtcagccgtacccctgccgggggcgagtggtgccttc
tccgaagacgacagtcatgtggaccaggacctggttgtaggcccagagatccttgtggat
tcatcagtgaacaatttgttgattggcaccacaggagtcatgttgcagagccctagagga
ggtcatgatgacgcccctcccctctcaccattgctacctccaatgcagaataacccaatc
caaaggaacttcagtggcctctcgggcccagacttgcacatggccgaaagtgttcgctgt
catttgaatttcgatcccaactctgcgcctggggttgctagagtttatgactcggtgcaa
agtagtggccccatggttgttacaagtcttacggaggagctgaagaagcttgcaaaacag
gggtggtattggggccccatcacacgctgggaggcagaggggaagttggcaaatgtgcca
gatggttcttttcttgtaagggatagttctgatgaccgttaccttttaagcctgagcttt
cgttcccatggtaaaacacttcacactagaattgagcactcaaatggtagattcagcttt
tatgaacagccagatgtggaagggcatacatctatagttgacttaatcgagcattcaatc
agggactctgaaaatggagcattttgttattcaagatctcgattgcctggatcagcaact
tacccagtcagactgaccaatccagtgtcacgattcatgcaggtgcgctcgctgcagtac
ctgtgccgctttgttatccgtcagtacaccagaatagacttaattcagaaactgcctttg
ccaaacaaaatgaaggattatttgcaggagaagcactactga

KEGG   Mus musculus (mouse): 56468
Entry
56468             CDS       T01002                                 

Gene name
Socs5, 1810018L08Rik, Cis, Cish5, SOC, mKIAA0671
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    56468 (Socs5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    56468 (Socs5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56468 (Socs5)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     56468 (Socs5)
SSDB
Motif
Pfam: SOCS SH2 SOCS_box
Other DBs
NCBI-GeneID: 56468
NCBI-ProteinID: NP_062628
MGI: 2385459
Ensembl: ENSMUSG00000037104
UniProt: O54928
Structure
PDB: 
2N34

Position
17; 17 E4
AA seq 536 aa
MDKVGKMWNNLKYRCQNLFSHEGGSRNENVEMNPNRCPSVKEKSISLGEAAPQQESSPLR
ENVALQLGLSPSKTFSRRNQNCAAEIPQVVEISIEKDSDSGATPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDTEKKFGRTRSGLQRRERRYGVSSMQDMDSVSSRAVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDGSAIPQTNCDSEEDSTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaagtggggaaaatgtggaacaacttaaaatacagatgccagaatctcttcagc
cacgagggaggaagccgtaatgagaacgtggagatgaaccccaacagatgtccgtctgtc
aaagagaaaagcatcagtctgggagaggcagctccccagcaagagagcagtcccttaaga
gaaaatgttgccttacagctgggactgagcccttccaagaccttttccaggcggaaccaa
aactgtgccgcagagatccctcaagtggttgaaatcagcatcgagaaagacagtgactcg
ggtgccaccccaggaacgaggcttgcacggagagactcctactcgcggcacgccccgtgg
ggaggaaagaagaaacattcctgttccacaaagacccagagttcattggataccgagaaa
aagtttggtagaactcgaagcggccttcagaggcgagagcggcgctatggagtcagctcc
atgcaggacatggacagcgtttctagccgcgcggtcgggagccgctccctgaggcagagg
ctccaggacacggtgggtttgtgttttcccatgagaacttacagcaagcagtcaaagcca
ctcttttccaataaaagaaaaatacatctttctgaattaatgctggagaaatgccctttt
cctgctggctcggatttagcacaaaagtggcatttgattaaacagcataccgcccctgtg
agcccacactcaacattttttgatacatttgatccatcactggtgtctacagaagatgaa
gaagataggcttcgcgagagaagacggcttagtatcgaagaaggggtggatccccctccc
aacgcacaaatacacacctttgaagctactgcacaggtcaacccattgtataagctggga
ccaaagttagctcctgggatgacagagataagtggagatggttctgcaattccacaaacg
aattgtgactcagaagaggattcaaccaccctatgtctgcagtcacggaggcagaagcag
cgccaggtgtccggggacagccacgcgcacgttagcagacagggagcttggaaagttcat
acgcagatcgattacatacactgcctcgtgccagatttgcttcagatcacagggaatccc
tgttactggggcgtgatggaccgatacgaggccgaagcccttctagaagggaaaccggaa
ggcacgttcttgctcagggactctgcacaggaggactacctcttctctgtgagcttccgc
cgctacaacaggtctctgcacgcccggatcgagcagtggaaccacaacttcagcttcgat
gcccatgacccctgcgtgtttcactcctccactgtcacggggcttctcgaacactataaa
gaccccagctcttgcatgttttttgaaccgttgctaacgatatcactgaatagaactttc
cctttcagcctgcagtatatctgccgcgcagtgatctgcagatgcactacgtatgatggg
attgacgggctcccgctaccgtcgatgttacaggattttttaaaagagtatcattataaa
caaaaagttagggttcgctggttagaacgagaaccagtcaaagcaaagtaa

KEGG   Mus musculus (mouse): 67296
Entry
67296             CDS       T01002                                 

Gene name
Socs4, 3110032M18Rik, A730004F22Rik, AI427843, AU015727, AU015859, So, Socs7
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  JAK-STAT signaling pathway
mmu04910  Insulin signaling pathway
mmu04917  Prolactin signaling pathway
mmu04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    67296 (Socs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    67296 (Socs4)
   04917 Prolactin signaling pathway
    67296 (Socs4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    67296 (Socs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    67296 (Socs4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     67296 (Socs4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2
Other DBs
NCBI-GeneID: 67296
NCBI-ProteinID: NP_543119
MGI: 1914546
Ensembl: ENSMUSG00000048379
Vega: OTTMUSG00000027545
UniProt: Q91ZA6 Q8C1K3
Position
14; 14 C1
AA seq 436 aa
MAENNSKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSESEAIGTVENVEIPLR
SQERQLSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSGRHSPGLPSKRKIH
ISELMLDKCPFPPRSDLAFRWHFIKRHTVPMSPNSDEWVSADLSERKLRDAQLKRRNTED
DIPCFSHTNGQPCVITANSASCTGGHITGSMMNLVTNNSIEDSDMDSEDEIITLCTSSRK
RNKPRWEMEEEILQLEAPPKFHTQIDYVHCLVPDLLQISNNPCYWGVMDKYAAEALLEGK
PEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEH
YKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSPMKLYLKEYH
YKSKVRLLRIDVPEQQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggctgaaaacaatagtaaaaatgtagatgtacggcctaaaacaagtcggagtcgaagt
gctgacaggaaggatggttatgtgtggagtggaaagaagttgtcttggtccaaaaagagt
gagagttgttctgaatctgaagccataggtactgttgagaatgttgaaattcctctaaga
agccaagaaaggcagcttagctgttcgtccattgagttggacttagatcattcctgtggg
catagatttttaggccgatcccttaaacagaaactgcaagatgcggtggggcagtgtttt
ccaataaagaattgtagtggccgacactctccagggcttccatctaaaagaaagattcat
atcagtgaactcatgttagataagtgccctttcccacctcgctcagatttagcctttagg
tggcattttattaaacgacacactgttcctatgagtcccaactcagatgaatgggtgagt
gcagacctgtctgagaggaaactgagagatgctcagctgaaacgaagaaacacagaagat
gacataccctgtttctcacataccaatggccagccttgtgtcataactgccaacagtgct
tcgtgtacaggtggtcacataactggttctatgatgaacttggtcacaaacaacagcata
gaagacagtgacatggattcagaggatgaaattataacgctgtgcacaagctccagaaaa
aggaataagcccaggtgggaaatggaagaggagatcctgcagttggaggcacctcctaag
ttccacacccagatcgactacgtccactgccttgttccagacctccttcagatcagtaac
aatccgtgctactggggtgtcatggacaaatatgcagccgaagctctgctggaaggaaag
ccagagggcacctttttacttcgagattcagcgcaggaagattatttattctctgttagt
tttagacgctacagtcgttctcttcatgctagaattgagcagtggaatcataactttagc
tttgatgcccatgatccttgtgtcttccattctcctgatattactgggctcctggaacac
tataaggaccccagtgcctgtatgttctttgagccgctcttgtccactcccttaatccgg
acgttccccttttccttgcagcatatttgcagaacggttatttgtaattgtacgacttac
gatggcatcgatgcccttcccattccttcgcctatgaaattgtatctgaaggaataccat
tataaatcaaaagttaggttactcaggattgatgtgccagagcagcagtga

DBGET integrated database retrieval system