KEGG   Mus musculus (mouse): 12709
Entry
12709             CDS       T01002                                 

Symbol
Ckb, B-CK, Bck, CPK-B, Ck-3, Ck3, Ckbb
Name
(RefSeq) creatine kinase, brain
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
Module
mmu_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    12709 (Ckb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12709 (Ckb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     12709 (Ckb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   12709 (Ckb)
SSDB
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Other DBs
NCBI-GeneID: 12709
NCBI-ProteinID: NP_067248
MGI: 88407
Ensembl: ENSMUSG00000001270
UniProt: Q04447
Position
12:complement(111635789..111638772)
AA seq 381 aa
MPFSNSHNTQKLRFPAEDEFPDLSSHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQTG
VDNPGHPYIMTVGAVAGDEESYDVFKDLFDPIIEERHGGYQPSDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLSGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcccttctccaacagccataatacgcagaagctgcgcttcccggccgaggatgagttc
cctgatctgagcagccacaacaaccatatggccaaggtgctgaccccggagctgtacgcc
gagctccgtgccaagtgcacgccgagcggctttactttggacgacgccattcagactggc
gtagacaatccgggccacccgtacatcatgactgtgggtgcagtggcgggcgacgaggag
agttacgacgtattcaaggacctcttcgaccccattattgaggagcggcacggcggctac
cagcccagtgatgagcacaagaccgacctcaacccagacaacctgcagggtggcgatgac
ctggaccccaactacgtgctgagctcgcgagtgcgcacaggccgcagcatccgcggcttc
tgtctccccccgcactgcagccgcggggagcgccgcgccatcgagaagctggcagtagaa
gctctgtccagcctagatggcgacctgtctggcaggtactacgcgctcaagagcatgact
gaggcggagcagcagcagctcattgacgaccacttcctcttcgataagcctgtgtcgcct
ctgctgctggcctccggcatggcccgggactggccggatgctcgtggcatatggcacaat
gacaataagactttcctggtgtggattaacgaggaggaccacctgcgagtcatctccatg
cagaaggggggcaacatgaaggaagtgttcacccgattctgcaccggcctcactcagatc
gaaactctcttcaagtccaagaactatgagttcatgtggaatcctcacctgggctacatc
ctcacatgcccatccaacctgggcaccggactgcgggcaggtgtgcacatcaagctgccc
cacctggggaagcacgagaagttctcggaggtgctcaagcggctgcggcttcagaagcga
ggcacaggtggcgtggacaccgctgctgtcggtggggtgtttgatgtctccaacgctgac
cgcctgggcttctcggaggtggaactggtgcagatggtggtggacggagtgaaactactc
attgagatggagcaacggctggagcagggtcaggcaatcgatgacctcatgccggcccag
aagtga

DBGET integrated database retrieval system