KEGG   Mus musculus (mouse): 12716
Entry
12716             CDS       T01002                                 

Gene name
Ckmt1, Mt-CK, ScCKmit, U-MtCK, UbCKmit, mi-CK, mia-CK
Definition
(RefSeq) creatine kinase, mitochondrial 1, ubiquitous
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
Module
mmu_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    12716 (Ckmt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12716 (Ckmt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     12716 (Ckmt1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   12716 (Ckmt1)
SSDB
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Other DBs
NCBI-GeneID: 12716
NCBI-ProteinID: NP_034027
MGI: 99441
Ensembl: ENSMUSG00000000308
Vega: OTTMUSG00000015261
UniProt: P30275 Q545N7
Position
2 E5; 2 60.37 cM
AA seq 418 aa
MAGPFSRLLSARPGLRLLALAGAGSLTAGILLRPESVGAAAAERRRLYPPSAEYPDLRKH
NNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFA
ELFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPAC
TRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAG
MARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQE
RGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDNRFPKILENLRLQKRGTGGVD
TAATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPPPLVHSKH
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggctggtcccttctcccgtctgctgtctgcccgccctggactcaggctcctggctttg
gctggagctgggtctctcaccgccgggattctgctccgcccggaatctgtaggagctgcc
gctgctgaacggaggagactgtatcccccgagcgctgagtacccagacctccgaaagcac
aacaactgcatggccagtcacctgaccccagcagtctatgcacggctctgcgacaagacc
acacccactggttggacactagatcagtgcatccagactggagtggacaaccctggccac
cccttcatcaagactgtgggcatggtggctggagatgaggagacctatgaggtatttgct
gaactgtttgaccctgtgatccaagagcggcataatggatatgaccccagaacaatgaag
cacaccactgaccttgatgccagtaaaatccgttctggctactttgatgagaggtatgta
ttgtcttcaagagtcagaactggccgaagtatcaggggactcagtctccctccagcctgc
actcgggcagagcgaagagaggtagaacgtgttgtggtggatgctctgagtggcctgaag
ggtgacctggctggacggtactataggctcagtgagatgacggaggccgaacagcagcag
cttattgatgaccattttctgtttgataaacctgtgtccccattgctgactgcagcagga
atggctcgagactggcctgatgctcgagggatctggcacaacaatgagaagagtttcttg
atctgggtgaatgaggaggaccacacacgggtcatctctatggagaaaggcggcaacatg
aagagagtgtttgaaagattctgccggggcctcaaagaggtggagaagctgatccaggaa
cgaggctgggagttcatgtggaatgagcgtttaggctacatcttgacctgtccatctaac
ctgggcactggacttcgggcaggagtccacatcaaactgccactgctgagcaaagataac
cgcttcccaaagatcctggagaacctaagactgcaaaagcgtggaactggaggagtggac
acagctgccacaggcagcgtctttgacatctctaatttggatcgacttggcaagtcagag
gtggagctggtgcagctcgtcatcgatggggtgaactatttgattgactgtgaacggcgt
ctggagagaggacaggatattcgaatccctccacctcttgtccacagcaaacattaa

DBGET integrated database retrieval system