KEGG   Mus musculus (house mouse): 12722
Entry
12722             CDS       T01002                                 
Symbol
Clca3a1, Cacc, Clca1
Name
(RefSeq) chloride channel accessory 3A1
  KO
K05030  calcium-activated chloride channel regulator 3/4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04924  Renin secretion
mmu04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    12722 (Clca3a1)
  09154 Digestive system
   04972 Pancreatic secretion
    12722 (Clca3a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12722 (Clca3a1)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   12722 (Clca3a1)
SSDB
Motif
Pfam: CLCA VWA VWA_2 VWA_CoxE MG2
Other DBs
NCBI-GeneID: 12722
NCBI-ProteinID: NP_034029
MGI: 1316732
Ensembl: ENSMUSG00000056025
UniProt: Q9QX15
Position
3:complement(144435438..144466738)
AA seq 902 aa
MVPGLQVLLFLTLHLLQNTESSMVHLNSNGYEGVVIAINPSVPEDERLIPSIKEMVTQAS
TYLFEASQGRVYFRNISILVPMTWKSKPEYLMPKRESYDKADVIVADPHLQHGDDPYTLQ
YGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAHLRWGVFDEYNVDQPFYMSRKN
TIEATRCSTRITGTNVVHNCERGNCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMFM
QNLNSVVEFCTEKNHNAEAPNLQNKMCNRRSTWDVIKTSADFQNAPPMRGTEAPPPPTFS
LLKSRRRVVCLVLDKSGSMDKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAAHIQNY
LIKITSSSDYQKITANLPQQASGGTSICHGLQAGFQAITSSDQSTSGSEIVLLTDGEDNG
IRSCFEAVSRSGAIIHTIALGPSAARELETLSDMTGGLRFYANKDLNSLIDAFSRISSTS
GSVSQQALQLESKAFDVRAGAWINGTVPLDSTVGNDTFFVITWMVKKPEIILQDPKGKKY
TTSDFQDDKLNIRSARLQIPGTAETGTWTYSITGTKSQLITMTVTTRARSPTMEPLLATA
HMSQSTAQYPSRMIVYARVSQGFLPVLGANVTALIEAEHGHQVTLELWDNGAGADTVKND
GIYTRYFTDYHGNGRYSLKVRVQAQRNKTRLSLRQKNKSLYIPGYVENGKIVLNPPRPDV
QEEAIEATVEDFNRVTSGGSFTVSGAPPDGDHARVFPPSKVTDLEAEFIGDYIHLTWTAP
GKVLDNGRAHRYIIRMSQHPLDLQEDFNNATLVNASSLIPKEAGSKETFKFKPETFKIAN
GIQLYIAIQADNEASLTSEVSNIAQAVKLTSLEDSISALGDDISAISMTIWGLTVIFNSI
LN
NT seq 2709 nt   +upstreamnt  +downstreamnt
atggtgccagggctgcaggtccttctgttcctcaccctgcatctcctgcagaacacagag
agctccatggtgcatctcaacagcaatggatacgagggtgtggtcattgccattaacccc
agtgtgccggaggacgaaaggctcatcccaagcataaaggaaatggtaactcaagcctct
acctacctgtttgaagccagccaaggaagagtttatttcagaaacataagcatattagtc
ccgatgacctggaagtcaaaacctgagtacttaatgccaaaacgagaatcgtatgacaaa
gcagacgtcatagttgcggatcctcacctgcaacatggagacgacccctacacccttcag
tatggacagtgtggggacagaggacagtacatacacttcactccaaacttcctactcact
gataacttgcgtatctacggaccccgaggcagagtctttgtccatgagtgggcccatctc
cggtggggagtatttgatgagtataacgtggaccagcctttctacatgtctagaaagaac
actatagaagcaacaaggtgttccaccaggatcactggcaccaatgtggttcacaactgt
gagagaggcaactgtgtcacaagggcgtgccggcgtgactcgaagacacggctgtatgaa
cccaaatgtacatttatcccagacaaaatacagacggctggggcctccataatgttcatg
caaaaccttaattctgtggttgaattttgcacagaaaaaaaccacaatgcagaagcccca
aacctacaaaacaaaatgtgcaatcgcagaagcacgtgggatgtaatcaagacgtctgct
gactttcagaatgcccctcccatgagaggaacagaagcccctcctccacctacattttca
ctgctcaagtccagaaggcgagtggtgtgcttggtgctggataaatctggaagcatggac
aaagaagaccgtcttattcgaatgaatcaagcagcagaactgtacttaactcaaattgtg
gaaaaggagtctatggttggattagtcacatttgacagcgctgcccacatccaaaattat
ctaataaaaataacgagtagtagtgactaccaaaagatcaccgcaaacctcccccaacag
gcttctggtggaacttcaatttgccatggactccaggcaggatttcaggcaattacctcc
agtgaccagagcacttccggttctgagatcgtattgctgacagatggggaagataatgga
atacgttcctgctttgaggccgtctctcgcagcggtgccatcatccacaccatcgctctg
gggccttcggctgcccgagaactggagactctgtcggacatgacaggagggcttcgtttc
tatgccaacaaagacctaaacagccttatcgatgctttcagtagaatttcatctacaagt
ggcagcgtctcccagcaggctctgcagttggagagcaaagccttcgatgtcagagcaggg
gcatggataaacggtacagtacctctggacagtaccgtcggcaacgacacgttctttgtt
atcacctggatggtaaaaaagccagaaatcattcttcaagatccaaaaggaaaaaaatat
acaacctcagatttccaagatgataaactaaacatccggtctgctagacttcaaataccg
ggcactgcagagacaggtacttggacttacagcatcacgggtaccaagtctcagttgatt
acaatgacagtgaccactcgagcaagaagtcccaccatggaaccactcctggctactgct
cacatgagtcagagcacagcccagtaccctagccggatgattgtgtacgcacgggtcagc
caaggatttttgcctgttctgggagccaatgtcacagccctcatagaagctgaacatgga
catcaagtcaccttggagctctgggacaatggggcaggtgctgatactgttaaaaatgat
ggcatctacacaagatactttacagattatcatggaaatggtagatacagcctaaaagtg
cgtgtccaggcacaaagaaacaaaaccagactgagcttaagacagaagaacaagtcttta
tatatacctggctatgtggaaaatggtaaaattgtactgaatccacccagaccagatgtc
caagaagaagccatagaagctacagtggaagacttcaacagagtaacctctggagggtcg
tttactgtgtctggagcgccccctgatggcgaccacgctcgtgtgttcccaccaagtaaa
gtcacagacctggaggctgagtttataggtgattatattcaccttacatggacggcccct
ggcaaggttctcgacaatggaagagcacatagatacatcatcagaatgagccagcatcct
ctggatctccaagaagattttaacaatgctactttagtgaatgcttccagtctgatacct
aaagaagctggctcaaaagaaacatttaaattcaaaccagaaacttttaaaatagcaaat
ggcatccagctctacattgcaatccaggcagacaatgaagccagtctcacctctgaggtc
tccaacatcgcacaggctgtcaagcttacttctctagaagatagtatctctgcactgggt
gatgatatttctgcaatctctatgacaatttgggggttaactgtgatttttaactctatt
ttaaactag

DBGET integrated database retrieval system