KEGG   Mus musculus (mouse): 12727
Entry
12727             CDS       T01002                                 

Gene name
Clcn4, Clc4-, Clc4-2, Clcn4-2, clC-4
Definition
(RefSeq) chloride channel, voltage-sensitive 4
  KO
K05012  chloride channel 3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    12727 (Clcn4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12727 (Clcn4)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel (CLC)
   12727 (Clcn4)
SSDB
Motif
Pfam: Voltage_CLC CBS
Other DBs
NCBI-GeneID: 12727
NCBI-ProteinID: NP_035464
MGI: 104571
Ensembl: ENSMUSG00000000605
Vega: OTTMUSG00000037804
UniProt: Q61418 Q8BQG0 Q8CBL5
Position
7 A1; 7 4.23 cM
AA seq 747 aa
MDFLEEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEFIKSLLDAWSGWVV
MLLIGLLAGTLAGVIDLAVDWMTDLKEGVCLSAFWYSHEQCCWTSNETTFEDRDKCPLWQ
KWSELLLSQSEGASAYILNYLMYILWALLFAFLAVSLVRVFAPYACGSGIPEIKTILSGF
IIRGYLGKWTLLIKTVTLVLVVSSGLSLGKEGPLVHVACCCGNFFSSLFSKYSKNEGKRR
EVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGN
SRLVLFYVEYHTPWYMAELFPFILLGVFGGLWGTLFTRCNIAWCRRRKTTRLGRYPVLEV
IAVTAVTAIVAYPNPYTRQSTSELISELFNDCGALESSQLCDYINDPNMTRPVDDIPDRP
AGVGVYTAMWQLALALIFKIVITIFTFGMKIPSGLFIPSMAVGAMAGRMVGIGVEQLAYH
HHDWIIFRNWCRPGADCVTPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLM
AAAVTSKWVADAFGKEGIYEAHIHLNGYPFLDVKDEFTHRTLATDVMRPRRGEPPLSVLT
QDSMTVEDVETLIKETDYNGFPVLVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSI
MYFTEEPPELPANSPHPLKLRRILNLSPFTVTDHTPMETVVDIFRKLGLRQCLVTRSGRL
LGIITKKDVLRHMAQMANQDPESIMFN
NT seq 2244 nt   +upstreamnt  +downstreamnt
atggacttcctcgaggagcccttccctgacgtggggacctacgaggacttccacaccata
gactggctgagggaaaagtcccgggataccgacagacataggaagatcaccagcaaaagt
aaggagtctatttgggagttcatcaagagcctgctggacgcgtggtcgggatgggtggtg
atgctactcattgggctgctggcaggtaccttggctggagtcatcgatctcgctgtggat
tggatgacggacctcaaggagggggtctgtctgtccgcattctggtacagccatgaacag
tgctgttggacctccaacgagaccacttttgaggacagggacaagtgtcccctgtggcag
aagtggtcagagcttcttctgagccagtcagagggcgccagcgcttacattctgaattac
ttaatgtacattctatgggcgttgctgtttgcatttctggctgtctccctggtacgtgtg
ttcgcaccgtatgcctgtggctctggcatacccgagataaagactattttgagtggcttt
atcatcaggggatacttggggaaatggactcttctaatcaagactgtcaccctcgtgctc
gtcgtatcctctggcctgagccttggcaaagagggcccactggtgcatgtggcatgttgc
tgtggcaacttcttcagcagccttttctccaagtatagcaagaatgaaggcaagaggcgt
gaggtgctttcagctgcagctgctgctggtgtctctgtggcctttggtgctccgatagga
ggtgtgctcttcagtctagaggaggtcagttactactttcccttgaaaaccttgtggagg
tcattctttgcagccctggtggctgccttcacactgcgctccatcaacccctttggaaat
agccgcctggttctcttttatgtggagtatcatacaccctggtacatggctgaactcttc
cctttcatcctgcttggagtctttgggggtttatggggaaccctcttcacacgctgcaac
attgcttggtgcaggaggcgtaagaccaccaggctgggcaggtacccagtgttggaggtt
attgcggtgacagccgtcaccgccatcgtggcctaccccaatccctacactcgccagagc
accagtgagctcatctctgagctcttcaacgattgtggggctctcgagtcttctcagctc
tgtgactacatcaacgaccccaacatgactcggcctgtggatgacattccggaccggccg
gctggggttggagtttacacagccatgtggcagctggccttggcactgatcttcaaaata
gtcattactatatttacctttggcatgaagattccctcaggtctcttcatccccagtatg
gctgtcggagccatggcaggccggatggtgggaatcggtgtggagcagctggcctaccat
caccatgactggatcatcttcaggaactggtgcaggcctggagcggactgtgtcacacca
gggctttatgcgatggtgggagctgcagcctgtctaggtggggtgactaggatgacagtg
tctctagtggtcattatgtttgaactgactggaggtctggagtatattgtacccctgatg
gcagctgctgtcaccagcaagtgggtggctgatgcctttgggaaagaagggatttatgaa
gcccacatccatctgaatgggtacccatttcttgatgtgaaggatgagttcacccaccgt
acgctggccactgatgtgatgcggccccggaggggagaaccgccattatcggtactaacc
caggacagcatgactgtggaggacgtggagactctcatcaaggagacagactacaacggc
tttcctgtgctcgtctccagagactcggagcgtctcatcgggtttgcccagaggcgggag
ctaatcttggctataaaaaatgccaggcagaggcaagagggcattgtgagcaattccatc
atgtacttcacagaggagcctcctgagctgcctgccaacagcccacatccactgaagctg
aggcgcattttgaacctgagccctttcacggtcacagatcacacccccatggagacggtg
gtggacattttccggaaactggggctccgacaatgcctggtgacacggagtgggagactt
cttgggatcatcacaaaaaaggatgttctgagacacatggcccagatggcaaaccaggac
cctgaatccatcatgtttaattag

DBGET integrated database retrieval system