KEGG   Mus musculus (mouse): 12750Help
Entry
12750             CDS       T01002                                 

Gene name
Clk4, AI987988, C85119
Definition
(RefSeq) CDC like kinase 4
  KO
K23561  dual specificity protein kinase CLK1/4 [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    12750 (Clk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12750 (Clk4)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    12750 (Clk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     12750 (Clk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CLK family
   12750 (Clk4)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    12750 (Clk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 12750
NCBI-ProteinID: NP_031740
MGI: 1098551
Ensembl: ENSMUSG00000020385
Vega: OTTMUSG00000005598
UniProt: O35493 Q4FJV9
Position
11; 11 B1.3
AA seq 481 aa AA seqDB search
MRHSKRTHCPDWDSRESWGHESYSGSHKRKRRSHSSTQENRHCKPHHQFKDSDCHYLEAR
CLNERDYRDRRYIDEYRNDYCEGYVPRHYHRDVESTYRIHCSKSSVRSRRSSPKRKRNRP
CASHQSHSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHG
MDGLHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPAHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPARRITLDEALQHPFFDLLKR
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcggcattccaaacgaactcactgtcctgattgggatagtagagaaagctggggccat
gaaagctacagtggaagtcacaaacgcaagagaaggtctcacagcagtactcaggagaac
aggcactgtaaaccacatcatcagtttaaagactcggattgtcactatttagaagcaaga
tgcttgaatgagagagattatcgggaccggagatacattgatgaatacagaaatgactac
tgcgaaggatatgttccaagacattaccatagagacgttgaaagcacttaccggatccat
tgcagtaaatcctcagtcaggagcaggagaagcagccctaagagaaagcgtaatagaccc
tgtgcaagtcatcagtcgcattcgaagagccaccgaaggaaaagatccaggagtatagag
gatgatgaggagggtcacctgatctgtcaaagtggagacgttctaagagcaagatatgaa
atcgtggacactttaggtgaaggagcctttggcaaagttgtagagtgcattgatcacggc
atggatggcttacatgtagcagtgaaaattgtaaaaaatgtaggccgttaccgggaggca
gctcgttctgaaatccaagtattggagcacttgaacagcactgaccccaacagtgtcttc
cgatgcgtccagatgctagagtggtttgatcatcatggtcatgtttgtattgtgtttgag
ctgctgggacttagtacctatgattttattaaagaaaatagttttctgccatttcaaatt
gatcacatcaggcaaatggcttatcagatctgccagtctataaattttttacatcataat
aaattaacacacacggacctaaaacctgaaaatattttatttgtgaagtctgactatgta
gtcaaatacaattctaaaatgaaacgagatgagcgcacattgaaaaacacagatatcaaa
gttgttgattttggaagtgcaacatatgacgacgaacatcatagtactttggtgtccaca
aggcactacagggctccagaggtcattttggctctaggttggtctcagccttgtgatgtt
tggagcataggctgcattcttattgagtactaccttgggttcacagtctttcagacccac
gatagtaaagagcacctggcaatgatggagcggatcttaggacccatcccagcacatatg
atccagaagacaaggaaacgcaagtatttccaccataaccagctagattgggacgagcat
agttcagctgggagatatgttaggagacgctgcaagccgttaaaggaatttatgctgtgt
catgacgaagagcatgagaagctgtttgacctggttcgaagaatgttggagtatgaccca
gcgagaaggatcaccttggatgaagcattgcagcaccctttctttgacttattaaaaagg
aaatga

DBGET integrated database retrieval system