KEGG   Mus musculus (mouse): 12757Help
Entry
12757             CDS       T01002                                 

Gene name
Clta, AV026556, Lca
Definition
(RefSeq) clathrin, light polypeptide (Lca)
  KO
K04644  clathrin light chain A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04144  Endocytosis
mmu04721  Synaptic vesicle cycle
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05016  Huntington disease
mmu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12757 (Clta)
   04142 Lysosome
    12757 (Clta)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    12757 (Clta)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    12757 (Clta)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    12757 (Clta)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12757 (Clta)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12757 (Clta)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12757 (Clta)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    12757 (Clta)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   12757 (Clta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q ORC3_N
Motif
Other DBs
NCBI-GeneID: 12757
NCBI-ProteinID: NP_001073853
MGI: 894297
Ensembl: ENSMUSG00000028478
Vega: OTTMUSG00000007204
UniProt: Q6PFA2
Position
4; 4 B1
AA seq 218 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTE
WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttggatccattcggcgctcccgccggtgcgcccggtggccccgctctagga
aacggggtggcgggcgccggcgaagaagacccggccgcggccttcttggcgcagcaagag
agtgagattgcgggcatcgagaacgatgaggccttcgccatcctggacggcggcgccccc
gggccgcagccacacggcgagccgccgggaggtccggatgctgttgacggagtgatgaat
ggtgaatactaccaggagagcaatggtccaacagacagttacgcagccatttcagaagtg
gatcgattgcagtcagagcctgaaagtatccgtaagtggagagaagagcagacagagcgc
ctggaagccctcgatgccaattctcggaagcaagaagcggagtggaaagaaaaggcgata
aaggagctggaagagtggtatgcgaggcaggacgagcagctacagaagacaaaggcaaac
aacagggcagcagaagaagcctttgtaaacgacattgacgagtcatccccaggcactgag
tgggagcgggtggcccgcctgtgtgactttaaccccaagtccagcaaacaggccaaagat
gtctctcgcatgcgctcagtcctcatctccctgaagcaggcccccctggtgcactga

DBGET integrated database retrieval system