KEGG   Mus musculus (mouse): 12757Help
Entry
12757             CDS       T01002                                 

Gene name
Clta, AV026556, Lca
Definition
(RefSeq) clathrin, light polypeptide (Lca)
  KO
K04644  clathrin light chain A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04144  Endocytosis
mmu04721  Synaptic vesicle cycle
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05016  Huntington disease
mmu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12757 (Clta)
   04142 Lysosome
    12757 (Clta)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    12757 (Clta)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    12757 (Clta)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    12757 (Clta)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    12757 (Clta)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12757 (Clta)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12757 (Clta)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    12757 (Clta)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   12757 (Clta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q ORC3_N
Motif
Other DBs
NCBI-GeneID: 12757
NCBI-ProteinID: NP_001073853
MGI: 894297
Ensembl: ENSMUSG00000028478
Vega: OTTMUSG00000007204
UniProt: Q6PFA2
Position
4; 4 B1
AA seq 218 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTE
WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttggatccattcggcgctcccgccggtgcgcccggtggccccgctctagga
aacggggtggcgggcgccggcgaagaagacccggccgcggccttcttggcgcagcaagag
agtgagattgcgggcatcgagaacgatgaggccttcgccatcctggacggcggcgccccc
gggccgcagccacacggcgagccgccgggaggtccggatgctgttgacggagtgatgaat
ggtgaatactaccaggagagcaatggtccaacagacagttacgcagccatttcagaagtg
gatcgattgcagtcagagcctgaaagtatccgtaagtggagagaagagcagacagagcgc
ctggaagccctcgatgccaattctcggaagcaagaagcggagtggaaagaaaaggcgata
aaggagctggaagagtggtatgcgaggcaggacgagcagctacagaagacaaaggcaaac
aacagggcagcagaagaagcctttgtaaacgacattgacgagtcatccccaggcactgag
tgggagcgggtggcccgcctgtgtgactttaaccccaagtccagcaaacaggccaaagat
gtctctcgcatgcgctcagtcctcatctccctgaagcaggcccccctggtgcactga

KEGG   Mus musculus (mouse): 67300Help
Entry
67300             CDS       T01002                                 

Gene name
Cltc, 3110065L21Rik, CHC, R74732
Definition
(RefSeq) clathrin, heavy polypeptide (Hc)
  KO
K04646  clathrin heavy chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04144  Endocytosis
mmu04721  Synaptic vesicle cycle
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05016  Huntington disease
mmu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    67300 (Cltc)
   04142 Lysosome
    67300 (Cltc)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    67300 (Cltc)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    67300 (Cltc)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    67300 (Cltc)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    67300 (Cltc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    67300 (Cltc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    67300 (Cltc)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    67300 (Cltc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   67300 (Cltc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD TPR_1
Motif
Other DBs
NCBI-GeneID: 67300
NCBI-ProteinID: NP_001003908
MGI: 2388633
Ensembl: ENSMUSG00000047126
Vega: OTTMUSG00000001209
UniProt: Q68FD5
Structure
PDB: 

Position
11; 11 C
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANASGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYKAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgcccattcgctttcaggagcatctccagctccagaacctgggtatc
aacccagcaaacattggcttcagtaccttgactatggagtcagacaaattcatctgcatt
agagaaaaagtgggagagcaggcccaggtggtaatcattgatatgaatgatccaagtaat
ccaattcgaagaccaatctcagcagacagtgccatcatgaatcctgccagcaaagtgatt
gcactgaaagctggcaaaactcttcagatatttaacattgaaatgaaaagtaaaatgaag
gcccataccatgactgatgatgtcaccttctggaaatggatctctttgaatacggttgct
cttgttacggataatgcagtttatcactggagtatggaaggagagtctcagccagtgaaa
atgtttgatcgtcattctagcctcgcaggatgccagatcatcaattaccgtacagatgca
aagcagaaatggttgcttctcactggcatatctgcacagcaaaatcgtgtggttggagct
atgcagctgtattctgtagataggaaagtttctcagcctattgaagggcatgcagctagt
tttgcacaatttaagatggaaggaaatgcagaagaatcaacattattttgttttgctgtg
cggggtcaggcaggaggaaagttacatatcattgaagttggtaccccacccacagggaat
caacccttcccaaagaaggcagtggatgttttctttcctccagaagcacaaaatgacttt
cctgttgcaatgcagatcagtgaaaagcatgatgtggtgttcttgattaccaagtatggt
tatattcacctctatgatcttgagactggcacgtgcatctacatgaacagaatcagcgga
gaaaccatcttcgtcactgcacctcatgaagccacagctggaataataggagtcaacaga
aagggacaggtcctgtcagtttgtgtggaagaggagaacataattccttatatcaccaat
gtcctacaaaatcctgacttggctctgagaatggctgtgcggaacaacttagctggtgct
gaagaactctttgcccggaaatttaatgctctcttcgcccagggaaactactcagaggct
gcaaaggtggctgctaatgctccaaagggaatccttcgtactccagataccatccgtcga
ttccagagtgtcccagctcagccaggtcaaacgtcacctctacttcagtatttcggaatc
cttttggaccagggccagctgaacaaatacgagtccttagagttatgtagacctgtactt
cagcaagggcggaaacagcttttggagaaatggctgaaagaagataagctggaatgttct
gaagaactgggtgatctcgttaaatctgtggacccaacattagcactgagtgtttacctc
agggccaatgtacctaataaagtcatccagtgctttgcagagacaggccaagtccagaag
attgttttatatgctaaaaaagttggctatactccagactggatctttctcctgagaaat
gtcatgcggatcagtccagatcaaggacagcagtttgctcaaatgttagttcaggatgaa
gagcctcttgctgatatcacccagattgtggatgtctttatggaatacaatctaatccaa
caatgtactgccttcttacttgatgctttgaagaataatcgtccctctgaaggtcctttg
cagacgcgattgcttgagatgaaccttatgcacgcacctcaagttgcagatgccattctc
gggaatcagatgttcacccactatgaccgggctcatatcgcccagctgtgtgagaaggcg
ggcctgctgcagcgtgcattagaacacttcaccgatttatatgacataaaacgtgcagtt
gttcatacccatcttcttaaccctgagtggttagtgaattactttgggtccttatcagtt
gaagattccctagaatgcctcagagccatgctgtcagctaatattcgtcaaaatctacag
atctgtgttcaggtggcttctaaatatcacgaacagctgtcaactcagtctctgattgag
ctctttgaatcattcaagagttttgaaggtctcttttattttctggggtccattgttaac
tttagtcaggacccagatgtgcactttaaatatattcaggcggcttgcaagactgggcaa
atcaaagaagtggaaagaatctgcagagaaagcaactgctatgatcccgagcgagtcaag
aattttctcaaggaggcaaaactaacagatcagttgccacttatcattgtctgtgatcgg
tttgactttgtccatgacctggtgctgtatttatatagaaacaatcttcagaagtatata
gagatatatgtccagaaggtaaatccaagtcgacttcctgtggttattggaggattgctg
gatgttgactgctctgaagatgtcattaaaaatttgattcttgttgtgagaggtcaattc
tctactgatgagcttgttgctgaagtcgagaaaagaaacagattgaagctgcttcttcct
tggcttgaggccagaattcatgagggctgtgaggagcctgctactcacaatgcacttgcc
aaaatatacattgacagtaacaacaacccagagagatttcttcgtgaaaacccttattat
gacagtcgtgttgttgggaagtactgtgagaagagagacccccatctggcttgtgttgct
tatgaacgtggccagtgtgacctggagctcatcaatgtttgcaatgagaattccctcttc
aaaagcctttctcgctacttagtccgtcgaaaggatccagaattgtggggtagtgtgcta
ctggaaagcaatccatacagaagaccgttaattgaccaggttgtacagacagccttgtct
gaaactcaggacccagaagaagtgtcagtaactgtgaaggcttttatgacagcagatctt
cctaatgagctcattgaactgctggagaaaatcgttcttgataactccgtattcagtgag
cacaggaatctgcaaaatctcctcatcctcactgcaattaaggctgaccgaacacgtgtt
atggagtatattaaccgcctggataattatgatgctccagatattgccaacattgccatc
agcaatgagctgtttgaagaggcatttgctattttccggaagtttgatgtcaatacttca
gcagtgcaggtgttgattgaacatattggaaacctggatcgtgcatatgagtttgctgaa
cgctgcaatgagcctgctgtttggagtcaacttgcaaaagctcagttgcagaaaggaatg
gtgaaggaagccattgattcttacatcaaagcagatgatccttcatcttacatggaagtt
gtccaggctgccaatgccagcggaaactgggaagaattggtgaagtatttgcagatggca
cgcaagaaggctcgagagtcctatgtggagacagaattgatatttgcactggctaaaaca
aaccgccttgcagaattagaagagttcatcaatgggccaaataatgctcatattcagcaa
gttggtgaccgttgttatgatgaaaaaatgtatgatgctgctaagttgttgtacaataat
gtttctaactttggacgcttggcatctacccttgttcaccttggcgagtatcaggcagca
gttgatggtgccagaaaagctaatagtactcgaacatggaaagaggtctgctttgcctgt
gtagatgggaaagagttccgccttgctcagatgtgtggactccatattgtggtgcatgca
gatgaattagaggagcttatcaactactatcaggatcgtggatattttgaagaactcatc
accatgttggaggcagccttgggactggagcgagctcacatgggaatgttcacagagcta
gctattttgtattctaaattcaagccacagaaaatgagagaacacctggagttgttctgg
tcgagagtgaatattcctaaggtgctgagagctgcagaacaggctcatctctgggcagag
ctggtgtttctgtatgacaagtacgaagagtatgacaatgccatcattaccatgatgaat
caccccaccgatgcatggaaggaagggcagttcaaagacatcatcaccaaggtggctaat
gtggaactgtactacaaagcaatccagttctacttagaattcaagcctttgttgttaaat
gacttgctcatggtgctgtctccacggttggatcacactcgtgcagtcaattatttcagc
aaggtaaaacagctaccactggtgaaaccatatttacgctcagtgcagaaccacaacaac
aaatctgtgaatgaatcactgaacaacctctttattactgaagaagattaccaggctctg
cgaacatcaatagatgcttatgacaactttgacaacatctcacttgctcagcgtttggaa
aaacacgaactcattgaattcagaagaattgctgcttatctcttcaaaggcaacaatcgc
tggaaacagagtgtagagttgtgcaagaaagacagcctttacaaggatgcaatgcagtat
gcctctgaatctaaagacacagaattggctgaagagctcctacagtggtttttgcaggaa
gaaaaaagagaatgctttggagcttgtctctttacctgttatgatctcttaaggccagat
gtcgtcctggaaaccgcatggagacataatatcatggatttcgccatgccctatttcatc
caggtcatgaaggaatatttgaccaaggtggataaattagatgcttcggagtcgctgaga
aaagaagaagaacaagctacagagacacagcccattgtttatggtcagccccagctgatg
ctaacagcaggacccagtgtggcagtccctccccaggcaccttttggttatggttatact
gcaccaccgtatgggcagccacagcctggctttgggtacagcatgtga

KEGG   Mus musculus (mouse): 74325Help
Entry
74325             CDS       T01002                                 

Gene name
Cltb, 2310046E19Rik, lcb
Definition
(RefSeq) clathrin, light polypeptide (Lcb)
  KO
K04645  clathrin light chain B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04144  Endocytosis
mmu04721  Synaptic vesicle cycle
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu05016  Huntington disease
mmu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    74325 (Cltb)
   04142 Lysosome
    74325 (Cltb)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    74325 (Cltb)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    74325 (Cltb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    74325 (Cltb)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    74325 (Cltb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    74325 (Cltb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    74325 (Cltb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q GED
Motif
Other DBs
NCBI-GeneID: 74325
NCBI-ProteinID: NP_001334441
MGI: 1921575
Ensembl: ENSMUSG00000047547
Vega: OTTMUSG00000032678
UniProt: Q6IRU5 Q3TJ95
Position
13; 13 B1
AA seq 229 aa AA seqDB search
MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLA
SGAGSEDMSTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAA
SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADTIGYVASEEAFV
KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggacttcggcttcttctcatcgtcggagagcggggccccggaggccgccgag
gaggacccagcggccgccttcctggcccagcaggaaagcgagattgctggcatcgagaat
gacccgggtttcggggcacctgccgccagccaggtggcctctgcgcagccgggactcgcg
agcggggctggttcagaggacatgagtactacagtcaatggagatgtgtttcaggaggct
aacgggcctgccgatggctacgctgcgattgcccaggcggacaggttgactcaggagccc
gagagcatccggaagtggagagaggagcagaagaaaaggctgcaggagttagacgctgcc
tcgaaggtgaccgaacaggagtggcgggagaaggccaagaaagacctggaggagtggaac
cagcgccaaagtgaacaggttgagaagaacaagatcaacaacaggatcgctgacaaagcg
ttctaccagcagccagatgctgataccattggctatgtggcatcggaagaggcttttgtg
aaagaatccaaggaggagaccccgggcacagagtgggagaaggtagcccagctgtgtgac
ttcaatcccaagagcagcaagcagtgtaaagatgtgtcccgcctgcgctcggtgctcatg
tccctgaagcaaacaccactgtcccgctag

DBGET integrated database retrieval system