KEGG   Mus musculus (mouse): 12759Help
Entry
12759             CDS       T01002                                 

Gene name
Clu, AI893575, ApoJ, Cli, D14Ucla3, SP-40, Sgp-2, Sgp2, Sugp-2
Definition
(RefSeq) clusterin
  KO
K17252  clusterin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12759 (Clu)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12759 (Clu)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12759 (Clu)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   12759 (Clu)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   12759 (Clu)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clusterin YlqD RE_AlwI
Motif
Other DBs
NCBI-GeneID: 12759
NCBI-ProteinID: NP_038520
MGI: 88423
Ensembl: ENSMUSG00000022037
Vega: OTTMUSG00000032654
UniProt: Q06890 Q549A5
Position
14 D1; 14 34.36 cM
AA seq 448 aa AA seqDB search
MKILLLCVALLLIWDNGMVLGEQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIE
KTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTC
MKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFA
RASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFH
NMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQ
CEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQ
LNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPE
EVSKDNPKFMDTVAEKALQEYRRKSRAE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctcctgctgtgcgtggcactgctgctgatctgggacaatggcatggtcctg
ggagagcaggaggtctctgacaatgagctccaagaactgtccactcaagggagtaggtat
attaataaggagattcagaacgccgtccagggagtgaagcacataaaaactctcatagaa
aaaaccaacgcagagcgcaagtccttgctcaacagtttagaggaagccaagaagaagaaa
gaggatgctctggaggacactagggattctgaaatgaagctgaaggcattcccggaagtg
tgtaacgagaccatgatggccctctgggaggagtgcaagccctgcctgaagcatacctgc
atgaagttctatgcacgtgtctgcaggagcggctcagggctggtcggccagcagctagag
gagtttctaaaccagagctcacccttctacttctggatgaacggcgaccgcatcgactcc
ctgctggagagtgaccggcagcagagccaagtcctggatgccatgcaggacagctttgct
cgggcatctggcatcatagacacgctctttcaggaccggttcttcgcccgtgagcttcat
gacccccactacttctcccccatcggcttcccacacaagaggcctcatttcttatatccc
aagtcccgcttggtccgcagcctcatgtctccctcccactatgggcctccgagcttccac
aacatgttccagcctttctttgagatgatccaccaggctcaacaggccatggatgtccag
ctccacagcccagccttccagttcccagacgtggatttcttaagagaaggtgaagatgac
cgcactgtgtgcaaggagatccgccgcaactccacaggatgcctgaagatgaagggccag
tgtgaaaagtgccaggagatcttgtctgtggactgttcaaccaacaatcctgcccaggct
aacctgcgccaggagctgaacgactcgctccaggtggccgagaggctgacagagcagtac
aaggagctgctgcagtccttccagtcgaagatgctcaacacctcatccctgctggagcag
ctgaacgaccagttcaactgggtgtcccagctggctaacctcacacagggcgaagacaag
tactaccttcgggtctccaccgtgaccacccattcctctgactcagaggtcccctcccgt
gtcactgaggtggtggtgaagctgtttgactctgaccccatcacagtggtgttaccagaa
gaagtctctaaggataaccctaagtttatggacacagtggcggagaaggcgctacaggaa
taccgcaggaaaagccgtgcggaatga

DBGET integrated database retrieval system