KEGG   Mus musculus (mouse): 12764
Entry
12764             CDS       T01002                                 

Gene name
Cmas, AW208911, CMPNeu5Ac, D6Bwg0250e
Definition
(RefSeq) cytidine monophospho-N-acetylneuraminic acid synthetase
  KO
K21749  N-acylneuraminate/3-deoxy-D-glycero-D-galacto-nononate cytidylyltransferase [EC:2.7.7.43 2.7.7.92]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    12764 (Cmas)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.43  N-acylneuraminate cytidylyltransferase
     12764 (Cmas)
    2.7.7.92  3-deoxy-D-glycero-D-galacto-nonulopyranosonate cytidylyltransferase
     12764 (Cmas)
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 DUF1593
Other DBs
NCBI-GeneID: 12764
NCBI-ProteinID: NP_034038
MGI: 1337124
Ensembl: ENSMUSG00000030282
Vega: OTTMUSG00000023787
UniProt: Q99KK2 A0A0R4J0B4
Structure
PDB: 
3EWI 1QWJ

Position
6 G2; 6 74.66 cM
AA seq 432 aa
MDALEKGAATSGPAPRGRPSRGRPPKLQRSRGAGRGLEKPPHLAALVLARGGSKGIPLKN
IKRLAGVPLIGWVLRAALDAGVFQSVWVSTDHDEIENVAKQFGAQVHRRSSETSKDSSTS
LDAIVEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSE
IQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRA
EHSVDIDVDIDWPIAEQRVLRFGYFGKEKLKEIKLLVCNIDGCLTNGHIYVSGDQKEIIS
YDVKDAIGISLLKKSGIEVRLISERACSKQTLSALKLDCKTEVSVSDKLATVDEWRKEMG
LCWKEVAYLGNEVSDEECLKRVGLSAVPADACSGAQKAVGYICKCSGGRGAIREFAEHIF
LLIEKVNNSCQK
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggacgcgctggagaagggggccgccacgtcggggcccgccccgcgtggacggccgtcc
cggggccggcccccgaagctgcagcgcagccggggcgcggggcgcggcctagagaagccg
ccgcacctggcagcgctggtgctggcccgcggcggcagcaaaggcatcccactgaagaac
atcaagcgcctggcgggggttccgctcattggctgggtcctgcgcgccgccctggatgcg
ggggtcttccagagtgtgtgggtttcaacagaccatgatgaaattgagaatgtggccaaa
cagtttggtgcacaggtccatcgaagaagttctgaaacgtccaaagacagctctacctca
ctagacgccattgtagaattcctgaattatcacaatgaggttgacattgtggggaatatc
caagccacatctccatgtttacatcccactgacctccagaaagttgcagaaatgatccga
gaagaaggatatgactctgtcttctccgttgtgaggcgccatcagtttcgatggagtgaa
attcagaaaggagttcgtgaagtgactgagcctctgaacttgaatccagcgaaacggcct
cgtcgacaagactgggatggagagttatatgagaacggctcattttattttgctaaaaga
catttgatagagatgggttacttacagggtgggaaaatggcatattatgaaatgcgagct
gagcacagtgtggatatcgacgtggacatcgattggccgatcgcagagcaaagagttctg
agatttggctattttggaaaagagaagctgaaggagataaagcttttggtttgtaatatt
gatggatgtctcaccaatggccacatttatgtatcaggagaccaaaaagaaataatatct
tatgatgtaaaagacgctattggcataagtttattaaagaaaagcggtattgaggtgagg
ctcatctcagaacgggcctgctccaagcagacgctctctgccctaaagctggactgtaaa
acagaagtcagtgtgtccgataagctggccaccgtggatgagtggaggaaggagatgggc
ctgtgctggaaagaagtggcctatctcggcaatgaagtgtctgatgaagaatgcctcaag
agagtgggcctgagcgctgttcctgccgacgcctgctccggggcccagaaggctgtgggg
tacatctgcaaatgcagcggtggccggggagccatccgcgagtttgcagagcacattttc
ctactgatagaaaaagttaataactcatgccaaaaatag

DBGET integrated database retrieval system