KEGG   Mus musculus (house mouse): 12765
Entry
12765             CDS       T01002                                 
Symbol
Cxcr2, CD128, CDw128, Cmkar2, Gpcr16, IL-8Rh, IL-8rb, IL8RA, Il8rb, mIL-8RH
Name
(RefSeq) chemokine (C-X-C motif) receptor 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    12765 (Cxcr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12765 (Cxcr2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12765 (Cxcr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12765 (Cxcr2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    12765 (Cxcr2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    12765 (Cxcr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12765 (Cxcr2)
   04050 Cytokine receptors [BR:mmu04050]
    12765 (Cxcr2)
   04090 CD molecules [BR:mmu04090]
    12765 (Cxcr2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    12765 (Cxcr2)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CXC Chemokine
   12765 (Cxcr2)
CD molecules [BR:mmu04090]
 Proteins
  12765 (Cxcr2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 12765
NCBI-ProteinID: NP_034039
MGI: 105303
Ensembl: ENSMUSG00000026180
UniProt: P35343
Position
1:74193153..74200405
AA seq 359 aa
MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINSYAVVVIYVLVTLL
SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWTFGSTLCKI
FSYVKEVTFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCIAMWLLSVILALPIL
ILRNPVKVNLSTLVCYEDVGNNTSRLRVVLRILPQTFGFLVPLLIMLFCYGFTLRTLFKA
HMGQKHRAMRVIFAVVLVFLLCWLPYNLVLFTDTLMRTKLIKETCERRDDIDKALNATEI
LGFLHSCLNPIIYAFIGQKFRHGLLKIMATYGLVSKEFLAKEGRPSFVSSSSANTSTTL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgggagaattcaaggtggataagttcaacattgaagatttcttcagtggagatcttgat
attttcaattatagctctggcatgccctctattctgccagatgctgtcccatgccactca
gagaacctggaaatcaacagttatgctgtggttgtaatatacgtcctggtgactctgctg
agccttgtggggaactccttggtgatgctggtcatcttatacaaccggagcacctgctct
gtcaccgatgtctacctgctgaacctggccattgctgacctgttctttgccctgaccttg
cctgtctgggctgcatctaaagtaaatggatggacttttggctcaaccctgtgcaagata
ttctcatacgtgaaggaggttaccttctacagcagtgttctgctactagcctgcatcagc
atggaccgctacctggccattgtacatgccacaagtacactgatccagaagagacacttg
gtcaagtttgtgtgcatagccatgtggttactatcagtaattctggccctgcccatctta
attctacgaaatcctgttaaggtaaacctttctaccttagtctgctatgaggatgtaggt
aacaatacatcccgtttgagggtcgtactgcgtatcctgcctcagacttttggcttcctc
gtgccgctgctcatcatgctgttctgctacgggttcacactgcgcaccctctttaaggcc
cacatggggcagaagcaccgggccatgcgggtcatcttcgctgtcgtccttgtcttcctg
ctctgctggctgccctacaacctggttctgttcacagacaccctcatgagaaccaagctg
atcaaggagacctgtgagcgccgcgatgacattgacaaggccttgaatgctacggagatt
cttggcttcctccacagctgccttaaccccatcatctatgcctttattggccagaaattt
cgccatggacttctcaagatcatggctacttatggccttgtcagcaaggagttcttagcc
aaggagggaaggccttcttttgttagctcgtcttcagcaaacacctctactaccctctaa

DBGET integrated database retrieval system