KEGG   Mus musculus (mouse): 12768Help
Entry
12768             CDS       T01002                                 

Gene name
Ccr1, Cmkbr1, Mip-1a-R
Definition
(RefSeq) chemokine (C-C motif) receptor 1
  KO
K04176  C-C chemokine receptor type 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12768 (Ccr1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12768 (Ccr1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    12768 (Ccr1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    12768 (Ccr1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12768 (Ccr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12768 (Ccr1)
   04050 Cytokine receptors [BR:mmu04050]
    12768 (Ccr1)
   04090 CD molecules [BR:mmu04090]
    12768 (Ccr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    12768 (Ccr1)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12768 (Ccr1)
CD molecules [BR:mmu04090]
 Proteins
  12768 (Ccr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1240
Motif
Other DBs
NCBI-GeneID: 12768
NCBI-ProteinID: NP_034042
MGI: 104618
Ensembl: ENSMUSG00000025804
Vega: OTTMUSG00000062930
UniProt: P51675 Q8BVW4 Q8BMH9
Position
9 F4; 9 75.05 cM
AA seq 355 aa AA seqDB search
MEISDFTEAYPTTTEFDYGDSTPCQKTAVRAFGAGLLPPLYSLVFIIGVVGNVLVILVLM
QHRRLQSMTSIYLFNLAVSDLVFLFTLPFWIDYKLKDDWIFGDAMCKLLSGFYYLGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGIITSIITWALAILASMPALYFFKAQWEFTH
RTCSPHFPYKSLKQWKRFQALKLNLLGLILPLLVMIICYAGIIRILLRRPSEKKVKAVRL
IFAITLLFFLLWTPYNLSVFVSAFQDVLFTNQCEQSKQLDLAMQVTEVIAYTHCCVNPII
YVFVGERFWKYLRQLFQRHVAIPLAKWLPFLSVDQLERTSSISPSTGEHELSAGF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagatttcagatttcacagaagcctaccccacaactacagaatttgactatggggac
tccactccatgccaaaagactgctgtaagagcctttggggctggactcctgccccccctg
tattctctagtgttcatcattggagtggtgggcaatgtcctagtgattctggtgctcatg
cagcataggaggcttcaaagcatgaccagcatctacctgttcaacctggctgtctctgat
ctggtcttccttttcactttacctttctggattgactacaagttgaaagacgactggatt
tttggtgatgccatgtgcaagcttctctctgggttttattacctgggtttatacagtgag
atcttctttatcatcctgttgacgattgacagatacctggccattgtccatgctgtgttt
gccctgagggcccgaactgttacttttggcatcatcaccagtattatcacctgggcccta
gccatcttagcttccatgcctgccttatacttttttaaggcccagtgggagttcactcac
cgtacctgtagccctcatttcccctacaagagcctgaagcagtggaagaggtttcaagct
ctaaagctaaaccttcttggactaattttgcctctgttagtcatgataatctgctatgca
gggatcatcagaattctgctcagaagacccagtgagaagaaggtcaaagccgtgcgtctg
atatttgctattactcttctattcttcctcctctggaccccctacaatctgagtgtattt
gtttctgctttccaagatgttctattcaccaatcagtgtgagcagagtaagcaactggac
ctggccatgcaggtgactgaggtgattgcctacacccactgttgtgtcaacccaatcatt
tatgtttttgtgggtgaacggttctggaagtaccttcggcagctgtttcaaaggcatgtg
gctataccactggcaaaatggctgcccttcctctctgtggaccaactagaaaggaccagt
tctatatctccatccacaggagaacatgagctctctgctggcttctga

DBGET integrated database retrieval system