KEGG   Mus musculus (mouse): 12769Help
Entry
12769             CDS       T01002                                 

Gene name
Ccr9, A130091K22Rik, Cmkbr10, GPR-9-6
Definition
(RefSeq) chemokine (C-C motif) receptor 9
  KO
K04184  C-C chemokine receptor type 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12769 (Ccr9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12769 (Ccr9)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    12769 (Ccr9)
   04062 Chemokine signaling pathway
    12769 (Ccr9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12769 (Ccr9)
   04050 Cytokine receptors [BR:mmu04050]
    12769 (Ccr9)
   04090 CD molecules [BR:mmu04090]
    12769 (Ccr9)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    12769 (Ccr9)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12769 (Ccr9)
CD molecules [BR:mmu04090]
 Proteins
  12769 (Ccr9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 12769
NCBI-ProteinID: NP_001160097
MGI: 1341902
Ensembl: ENSMUSG00000029530
Vega: OTTMUSG00000036110
UniProt: Q9WUT7
Position
9 F4; 9 74.33 cM
AA seq 369 aa AA seqDB search
MMPTELTSLIPGMFDDFSYDSTASTDDYMNLNFSSFFCKKNNVRQFASHFLPPLYWLVFI
VGTLGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAAGQWMFQTFMCK
VVNSMYKMNFYSCVLLIMCISVDRYIAIVQAMKAQVWRQKRLLYSKMVCITIWVMAAVLC
TPEILYSQVSGESGIATCTMVYPKDKNAKLKSAVLILKVTLGFFLPFMVMAFCYTIIIHT
LVQAKKSSKHKALKVTITVLTVFIMSQFPYNSILVVQAVDAYAMFISNCTISTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
ETTSGALSL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccacagaactcacaagccttattcctggcatgtttgatgacttcagctatgac
tccactgcttccacagatgactacatgaatttgaatttcagtagcttcttctgtaagaaa
aataatgtcaggcagtttgcaagccattttcttccacctctgtactggcttgtgttcatt
gtgggcaccttgggcaacagcctggtcatccttgtctactggtattgcacaagagtgaag
accatgactgacatgttccttttgaatttagccattgctgatctgctctttcttgccact
cttcccttctgggccattgctgctgctggtcaatggatgttccagaccttcatgtgcaag
gttgtgaacagcatgtacaagatgaacttctacagctgtgtgcttctcatcatgtgcatc
agtgtggacagatacattgccattgtacaggccatgaaggctcaggtctggaggcagaaa
aggctgctatacagcaagatggtctgcattaccatctgggtgatggcagctgtgctctgc
accccagaaatcctgtacagtcaagtcagtggggaatctggtattgccacatgtaccatg
gtctaccctaaggataagaatgccaagctaaagtcagctgtcttgatcctgaaggtcacc
ttggggtttttcctcccctttatggtcatggccttctgctataccatcatcattcatacc
ttggtacaggccaagaagtcatccaagcacaaggccctcaaggtgaccatcactgtcctc
actgtcttcattatgtctcagttcccctacaactccattcttgtagtgcaggctgttgac
gcttatgccatgttcatctccaactgcactatttccaccaatattgacatctgcttccag
gttactcagactattgcattcttccacagttgtctgaacccagttctctatgtttttgtt
ggcgagagattccgaagggatctggtgaagaccctgaagaacctgggatgcattagccag
gcccagtgggtttcattcacaaggagagagggtagcttgaagctttcttctatgctactg
gagacaacttcgggggctctctccctatga

DBGET integrated database retrieval system