KEGG   Mus musculus (mouse): 12773Help
Entry
12773             CDS       T01002                                 

Gene name
Ccr4, C-C_CKR-4, CHEMR1, Cmkbr4, LESTR, Sdf1r
Definition
(RefSeq) chemokine (C-C motif) receptor 4
  KO
K04179  C-C chemokine receptor type 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12773 (Ccr4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12773 (Ccr4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    12773 (Ccr4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12773 (Ccr4)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    12773 (Ccr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12773 (Ccr4)
   04050 Cytokine receptors [BR:mmu04050]
    12773 (Ccr4)
   04090 CD molecules [BR:mmu04090]
    12773 (Ccr4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    12773 (Ccr4)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12773 (Ccr4)
CD molecules [BR:mmu04090]
 Proteins
  12773 (Ccr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 12773
NCBI-ProteinID: NP_034046
MGI: 107824
Ensembl: ENSMUSG00000047898
Vega: OTTMUSG00000062518
UniProt: P51680
Position
9 F3; 9 64.49 cM
AA seq 360 aa AA seqDB search
MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVV
VLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVG
FYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYT
EHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRA
VRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLN
PVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccacagaggtcacagacaccacccaggatgaaactgtgtacaatagttattac
ttctacgaaagcatgccaaagccttgcaccaaggaaggtatcaaggcatttggggaggtc
ttcctgcctcctctctactccttggtcttcttgttgggtctgtttggaaattctgttgtg
gttctggtcctgttcaaatacaagaggctcaagtccatgacggacgtgtacctgctgaac
ctggccatctcggatttgctgttcgtcctgtccctcccattctggggctactacgccgcc
gaccagtgggtttttggactaggtctgtgcaagatcgtttcatggatgtacctggtgggc
ttctacagcggcatcttcttcatcatgctcatgagcatagacagatacctggccatcgtg
cacgcggtattctccttgaaggcaaggaccctgacctatggcgtcatcaccagcctgatc
acgtggtcagtggctgtgtttgcctccctcccaggcctcttgttcagcacttgctacaca
gagcacaaccacacgtactgcaaaacccagtactcggtcaactcgacgacgtggaaagtc
ctcagctccctggagatcaacgtcctggggctgcttatccccctgggcatcatgctgttt
tgttattccatgatcattaggactctgcaacactgcaagaatgagaagaagaacagagca
gtgcgcatgatcttcgccgtggtggtcctcttcctcggcttctggacgccgtacaacgtg
gtgcttttcctggagacgctggtggagcttgaagtccttcaggactgcaccttggagagg
tacctagactacgccatccaggctacagaaaccctggccttcattcactgctgccttaac
cccgtcatttacttctttctcggggagaaattccgcaagtacatcacccaactcttcaga
acatgccggggtcccctcgtgctctgcaaacactgtgacttcctccaggtctactcggct
gacatgtccagctcctcttacacgcagtccactgtggatcatgacttccgtgacgctttg
taa

DBGET integrated database retrieval system