KEGG   Mus musculus (mouse): 12774Help
Entry
12774             CDS       T01002                                 

Gene name
Ccr5, AM4-7, CD195, Cmkbr5
Definition
(RefSeq) chemokine (C-C motif) receptor 5
  KO
K04180  C-C chemokine receptor type 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu05145  Toxoplasmosis
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12774 (Ccr5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12774 (Ccr5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    12774 (Ccr5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    12774 (Ccr5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12774 (Ccr5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    12774 (Ccr5)
   05163 Human cytomegalovirus infection
    12774 (Ccr5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12774 (Ccr5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    12774 (Ccr5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12774 (Ccr5)
   04050 Cytokine receptors [BR:mmu04050]
    12774 (Ccr5)
   04090 CD molecules [BR:mmu04090]
    12774 (Ccr5)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    12774 (Ccr5)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12774 (Ccr5)
CD molecules [BR:mmu04090]
 Proteins
  12774 (Ccr5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srab
Motif
Other DBs
NCBI-GeneID: 12774
NCBI-ProteinID: NP_034047
MGI: 107182
Ensembl: ENSMUSG00000079227
Vega: OTTMUSG00000035282
UniProt: P51682
Position
9 F4; 9 75.05 cM
AA seq 354 aa AA seqDB search
MDFQGSVPTYSYDIDYGMSAPCQKINVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISC
KKLKSVTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFF
IILLTIDRYLAIVHAVFALKVRTVNFGVITSVVTWAVAVFASLPEIIFTRSQKEGFHYTC
SPHFPHTQYHFWKSFQTLKMVILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIF
AIMIVYFLFWTPYNIVLLLTTFQEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYA
FVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggattttcaagggtcagttccgacctatagctatgacatcgattatggtatgtcagca
ccctgccaaaaaatcaatgtgaaacaaattgcggctcagctcctgcccccactctactcc
ctggtattcatctttggttttgtgggtaacatgatggtcttcctcatcttgataagctgc
aaaaagctgaagagcgtgactgatatctacctgctcaacctggccatctctgacctgctc
ttcctgctcacactaccattctgggctcactatgctgcaaatgagtgggtctttgggaac
ataatgtgtaaagtattcacagggctctatcacattggttattttggtggaatcttcttc
attatcctcctgacaattgataggtacttggctattgtccatgctgtgtttgctttaaaa
gtcagaacggtcaactttggggtgataacaagtgtagtcacttgggcggtggctgtgttt
gcctctctcccagaaataatctttaccagatctcagaaagaaggttttcattatacatgc
agtcctcattttccacacactcagtatcatttctggaagagtttccaaacattaaagatg
gtcatcttgagcctgatcctgcctctacttgtcatggtcatctgctactcaggaattctc
cacaccctgtttcgctgtaggaatgagaagaagaggcacagggctgtgaggctcatcttt
gccatcatgattgtctactttctcttctggactccctacaacattgtcctcctcctgacc
accttccaggaattctttggactgaataactgcagtagttctaatagactagaccaggcc
atgcaggcaacagagactcttggaatgacacactgctgcctaaaccctgtcatctatgcc
tttgttggagagaagttccggagttatctctcagtgttcttccgaaaacacatggtcaaa
cgcttttgcaaacggtgttcaattttccagcaagacaatcctgatcgtgcaagctcagtc
tatacccgatccacaggagaacatgaagtttctactggtttatga

DBGET integrated database retrieval system