KEGG   Mus musculus (mouse): 12775Help
Entry
12775             CDS       T01002                                 

Gene name
Ccr7, CC-CKR-7, CCR-7, CD197, Cdw197, Cmkbr7, EBI1, Ebi1h
Definition
(RefSeq) chemokine (C-C motif) receptor 7
  KO
K04182  C-C chemokine receptor type 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12775 (Ccr7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12775 (Ccr7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    12775 (Ccr7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12775 (Ccr7)
   04050 Cytokine receptors [BR:mmu04050]
    12775 (Ccr7)
   04090 CD molecules [BR:mmu04090]
    12775 (Ccr7)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    12775 (Ccr7)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12775 (Ccr7)
CD molecules [BR:mmu04090]
 Proteins
  12775 (Ccr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 12775
NCBI-ProteinID: NP_031745
MGI: 103011
Ensembl: ENSMUSG00000037944
Vega: OTTMUSG00000006448
UniProt: P47774
Position
11; 11 D
AA seq 378 aa AA seqDB search
MDPGKPRKNVLVVALLVIFQVCFCQDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWF
LPLMYSVICFVGLLGNGLVILTYIYFKRLKTMTDTYLLNLAVADILFLLILPFWAYSEAK
SWIFGVYLCKGIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
GIWMLALFLSIPELLYSGLQKNSGEDTLRCSLVSAQVEALITIQVAQMVFGFLVPMLAMS
FCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCET
SKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDLFKLFKDLGCLSQERLRHWSSCRH
VRNASVSMEAETTTTFSP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacccagggaaacccaggaaaaacgtgctggtggtggctctccttgtcattttccag
gtgtgcttctgccaagatgaggtcaccgatgactacatcggcgagaataccacggtggac
tacaccctgtacgagtcggtgtgcttcaagaaggatgtgcggaactttaaggcctggttc
ctgcctctcatgtattctgtcatctgcttcgtgggcctgctcggcaacgggctggtgata
ctgacgtacatctatttcaagaggctcaagaccatgacggatacctacctgctcaacctg
gccgtggcagacatccttttcctcctaattcttcccttctgggcctacagcgaagccaag
tcctggatctttggcgtctacctgtgtaagggcatctttggcatctataagttaagcttc
ttcagcgggatgctgctgctcctatgcatcagcattgaccgctacgtagccatcgtccag
gccgtgtcggctcatcgccaccgcgcccgcgtgcttctcatcagcaagctgtcctgtgtg
ggcatctggatgctggccctcttcctctccatcccggagctgctctacagcggcctccag
aagaacagcggcgaggacacgctgagatgctcactggtcagtgcccaagtggaggccttg
atcaccatccaagtggcccagatggtttttgggttcctagtgcctatgctggctatgagt
ttctgctacctcattatcatccgtaccttgctccaggcacgcaactttgagcggaacaag
gccatcaaggtgatcattgccgtggtggtagtcttcatagtcttccagctgccctacaat
ggggtggtcctggctcagacggtggccaacttcaacatcaccaatagcagctgcgaaacc
agcaagcagctcaacattgcctatgacgtcacctacagcctggcctccgtccgctgctgc
gtcaaccctttcttgtatgccttcatcggcgtcaagttccgcagcgacctcttcaagctc
ttcaaggacttgggctgcctcagccaggaacggctccggcactggtcttcctgccggcat
gtacggaacgcgtcggtgagcatggaggcggagaccaccacaaccttctccccgtag

DBGET integrated database retrieval system