KEGG   Mus musculus (mouse): 12785
Entry
12785             CDS       T01002                                 

Gene name
Cnbp, AA408710, Cnbp1, Znf9
Definition
(RefSeq) cellular nucleic acid binding protein
  KO
K09250  cellular nucleic acid-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12785 (Cnbp)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Zinc fingers of alternating composition
    12785 (Cnbp)
SSDB
Motif
Pfam: zf-CCHC zf-CCHC_5 zf-CCHC_4 zf-CCHC_3 zf-CCHC_2
Other DBs
NCBI-GeneID: 12785
NCBI-ProteinID: NP_038521
MGI: 88431
Ensembl: ENSMUSG00000030057
Vega: OTTMUSG00000023465
UniProt: P53996 Q5QJQ9
Position
6; 6 D1
AA seq 178 aa
MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGES
GHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKC
YSCGEFGHIQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
NT seq 537 nt   +upstreamnt  +downstreamnt
atgagcagcaacgaatgcttcaagtgtggacgatctggccactgggccagggagtgccct
actggtggaggtcggggtcgtggaatgagaagccgcggcagaggtggttttacctcggat
agagggttccagtttgtttcctcgtctctccctgacatctgctaccgctgtggtgagtct
ggtcatcttgccaaggattgtgatctgcaggaggatgaagcctgctataactgcggtaga
ggtggccacattgccaaggactgcaaggagcccaagagagagcgagagcaatgctgctac
aattgtggcaagccaggccatctggctcgtgactgtgaccacgcggatgagcagaagtgc
tattcttgtggtgaatttggacatattcaaaaagactgcaccaaggtgaagtgctatagg
tgtggtgaaactggtcatgtagccatcaattgcagcaagacaagtgaagtcaactgttac
cgctgtggcgagtcagggcatcttgcacgggaatgcacaattgaggctacagcctaa

DBGET integrated database retrieval system