KEGG   Mus musculus (mouse): 12789Help
Entry
12789             CDS       T01002                                 

Gene name
Cnga2, CNG2, Cnca, Cncg4, OCNC1
Definition
(RefSeq) cyclic nucleotide gated channel alpha 2
  KO
K04949  cyclic nucleotide gated channel alpha 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    12789 (Cnga2)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    12789 (Cnga2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12789 (Cnga2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   12789 (Cnga2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CLZ cNMP_binding Ion_trans_2 XRCC4 Mod_r
Motif
Other DBs
NCBI-GeneID: 12789
NCBI-ProteinID: NP_031750
MGI: 108040
Ensembl: ENSMUSG00000005864
Vega: OTTMUSG00000017812
UniProt: Q62398 A3KGE1
Position
X; X A7.3
AA seq 664 aa AA seqDB search
MMTEKSNGVKSSPANNHNHHPPPSIKANGKDDHRAGSRPQSVAADDDTSSELQRLAEMDT
PRRGRGGFRRIVRLVGIIRDWANKNFREEEPRPDSFLERFRGPELQTVTTHQGDGKGDKD
GEGKGTKKKFELFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQRNYFVVWLVL
DYFSDTVYIADLIIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLIYFAV
GIHSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYAISK
SIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFL
IGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEAKVIKWFDYLWT
NKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPG
DYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTA
NIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVAASMEVDVQ
EKLEQLETNMETLYTRFARLLAEYTGAQQKLKQRITVLETKMKQNHEDDYLSDGINTPEP
AVAE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgaaaaatccaacggtgtgaagagctctccagctaataaccataaccatcat
cctcctccttctatcaaggccaatggcaaagatgaccacagggcaggtagcagaccacag
tctgtggcagctgatgatgacacttcctcagaactgcaaaggttggcagagatggatact
ccacgcaggggaaggggtggcttccgaaggattgtccgcctggtggggatcatcagagac
tgggccaacaaaaatttccgtgaggaggaaccaagacctgactccttcctagagcgtttc
cgtgggcctgagctccagactgtgacaacccatcagggggatggcaaaggcgacaaggac
ggcgagggaaagggcaccaaaaagaaatttgaactgtttgttttggacccagctggagac
tggtattaccgttggttgtttgtcattgccatgcctgttctttacaactggtgtctgttg
gtagccagagcctgcttcagtgatctacagagaaactattttgtggtatggctggtgctg
gattacttctcagacactgtttatattgcagacctcatcattcggctgcgcacaggcttc
ctagaacaagggctcctggtcaaagaccccaagaaattgcgagacaactatatccacact
ttgcagttcaaattggatgtggcttctatcatccccactgacctcatttattttgctgtg
ggtatccacagccctgaggtacgctttaatcgtctgttacactttgcccgtatgtttgag
ttctttgaccgcactgagacacgtacaagctaccccaacatcttccgaatcagcaacctg
gtcctctacatcttggtcatcatccactggaatgcttgtatttactatgctatctctaag
tccattggctttggggttgacacctgggtttaccccaacattactgaccctgaatatggc
tacctggctagggagtacatttactgcctttactggtccacactgaccctcaccaccatt
ggagagacaccaccccctgtaaaggatgaggagtacctatttgtcatctttgacttcctg
attggtgtcctcatctttgccactattgtgggaaatgtgggctccatgatctccaacatg
aatgccacacgagcagagttccaggccaagattgatgctgtcaaacactacatgcagttc
cgaaaggtcagtaaagacatggaagccaaggtcatcaaatggtttgactacttgtggacc
aataagaagacagtagatgaacgagaagtcctaaagaacctgcctgcaaagcttagggca
gagatagccattaatgttcatttgtccactctgaagaaagtgcgcatattccaggattgt
gaagctggcctgctggtggaactggtactgaagcttcgtcctcaggtctttagtcctgga
gattatatttgccgtaagggggacattggcaaggaaatgtacatcatcaaggagggcaaa
ttggcagtggtagctgatgatggtgtgactcagtatgccttgctgtcagctgggagctgc
tttggtgagattagtatccttaacattaagggtagcaaaatgggcaatcggcgcactgcc
aatatccgtagtctgggctactcagatctcttctgcttgtccaaggatgatcttatggaa
gctgtgactgagtatcctgatgccaagaaagtcctggaagaacggggtagggagatcctg
atgaaggaaggtctactggatgagaatgaagtggcagctagtatggaggtagatgttcag
gagaagctggagcagctggagacaaacatggagaccttgtacactcgttttgcccgcctg
ctggctgagtacactggagcccagcagaagctcaaacagcgcatcacagtgctggagacc
aagatgaaacagaaccatgaggatgattacctatcagatgggataaacacccctgagcca
gctgttgctgaatag

KEGG   Mus musculus (mouse): 233649Help
Entry
233649            CDS       T01002                                 

Gene name
Cnga4
Definition
(RefSeq) cyclic nucleotide gated channel alpha 4
  KO
K04951  cyclic nucleotide gated channel alpha 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    233649 (Cnga4)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    233649 (Cnga4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    233649 (Cnga4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   233649 (Cnga4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CLZ cNMP_binding
Motif
Other DBs
NCBI-GeneID: 233649
NCBI-ProteinID: NP_001028489
MGI: 2664099
Ensembl: ENSMUSG00000030897
Vega: OTTMUSG00000060484
UniProt: Q3UW12
Position
7; 7 E3
AA seq 575 aa AA seqDB search
MSQDSKVKTTESTPPAPTKARKWLPVLDPSGDYYYWWLNTMVFPIMYNLIIVVCRACFPD
LQHSYLVAWFVLDYTSDLLYLLDIGVRFHTGFLEQGILVVDKSMIASRYVRTWSFLLDLA
SLVPTDAAYVQLGPHIPTLRLNRFLRVPRLFEAFDRTETRTAYPNAFRIAKLMIYIFVVI
HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPLPAR
EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRRLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGVTQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQAVMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLKGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPDDMGEADDEAEPGEGTSKDGEEKAGQEGPSGLE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggacagcaaagtgaagacaacagagtccacgcccccagccccaaccaaagcc
aggaagtggctgccagtcctagacccatctggggattattactactggtggctgaacacg
atggtcttcccaatcatgtataatctcatcatcgttgtatgcagggcctgctttcctgac
ttgcaacacagttacctggtggcctggtttgtgctggactacacgagtgacctgctgtac
ctactagatattggggtacgcttccacacaggattcctagaacagggcatcctggtggta
gacaaaagcatgatcgccagtcgctatgtacgcacctggagcttcctgttggacctggct
tccctggtccccacagatgcagcctacgtgcagctaggcccccacatccctacactccgg
ctaaaccgctttctccgagtgcctcgcctctttgaggctttcgaccgtacagagacccgc
acagcttacccaaatgccttccgcatagccaagctgatgatctacatttttgtcgtcatc
cattggaacagctgcttatacttcgccctgtccaggtacctgggcttcggacgggatgca
tgggtatacccagaccctgcgcagcctggctttgagcgcttgcggcgccagtatctctac
agcttctacttctccactctgatcctgaccactgtgggtgacacaccgctgccagcccga
gaggaagagtacctcttcatggtgggtgacttcctgctggccgtcatgggtttcgccacc
atcatgggtagcatgagctctgtcatttacaacatgaacacggcagatgcagccttctac
ccagaccatgctctggtaaagaaatacatgaagctacagcacgtcaaccgaaggctggag
cggcgcgttattgactggtaccagcatctgcagatcaacaagaagatgaccaatgaggta
gccatcttgcagcacttgcctgagcggctgcgggcagaggtcgctgtatccgtacacctg
tctaccctgagccgagtacagatcttccagaactgtgaagccagcctgctggaagagctg
gtgctaaagctccagccccagacctactcaccaggcgaatacgtatgccgcaaaggggac
attggccgagagatgtacatcatccgcgagggccagctggctgtggtggcagatgacggt
gtcacacagtatgctgtgcttggtgcagggctctactttggggagattagcatcatcaac
atcaaagggaacatgtctggaaaccgacgaacagctaacatcaagagcctgggctattca
gacctcttctgcctcagcaaggaggatctacgggaggtgctgagtgagtacccacaggcc
caggcagtcatggaggagaagggccgtgaaatcttgctcaaaatgaataaattggatgtg
aatgctgaggcagctgagatcgccctccaggaggccacagagtctcggctgaaaggcctc
gaccagcagcttgatgacctacagaccaagtttgctcgcctcctggctgagctggagtcc
agcgcactgaagatagcttaccgcattgaaaggctggagtggcagactcgagagtggccg
atgccagacgacatgggtgaggctgatgatgaggctgagcctggagaaggaacgtccaag
gatggagaggaaaaagctggccaggagggaccctcaggcctagaatga

KEGG   Mus musculus (mouse): 333329Help
Entry
333329            CDS       T01002                                 

Gene name
Cngb1, Cngb1b, Garp2, Gm1959
Definition
(RefSeq) cyclic nucleotide gated channel beta 1
  KO
K04952  cyclic nucleotide gated channel beta 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04740  Olfactory transduction
mmu04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    333329 (Cngb1)
   04022 cGMP-PKG signaling pathway
    333329 (Cngb1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    333329 (Cngb1)
   04740 Olfactory transduction
    333329 (Cngb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    333329 (Cngb1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   333329 (Cngb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Trypan_PARP
Motif
Other DBs
NCBI-GeneID: 333329
NCBI-ProteinID: NP_001182342
MGI: 2664102
Ensembl: ENSMUSG00000031789
Vega: OTTMUSG00000031171
UniProt: Q91WA8 E1AZ71 Q80XL8 Q80VQ4
Position
8; 8 C5
AA seq 1325 aa AA seqDB search
MLGWVQRVLPQPPGTPQKTVETAGPQPETESKPEANPQPEPEPQQEPEPEPEPEPEPEPE
PEPEPEPEPEPEPEPVPEEAPPEVQALPPEEPMEGEGEAEAGPSLQETQVADPAQPTSQA
QVAVAKVNRPSSWMLSWFWRGMQKVVPQPVCSNGGQNLAAGERDPDQGGAQIPEPCGTGD
PGSAEASGTQDTEPSLWLLRWLEQNLEKVLPQPPPPSLAWKVEPEAAVLDPDPPGTPMQM
EPTESPSQPNPGPLEPEEEPAAEPQPGFQSSSLPPPGDPVRLIEWLLHRLEMALPQPVLH
GKAAEQEPGCPGMCDVQTISILPVEQVEHDLVLEEVDSCWEDAQQEDGASPQETEVAPAH
EEESEAIVEIPRELTKIQEEREDEQEEDEEEKEEEKKKGEEEKEKEEEEKEKEKEKEEEK
EEEEKEEEEEEEKEEEEEEKEEEEKEEEEKEEEEEEEEEEEEPIVLLDSCLVVQADVDEC
QLERTPSELASIQELPEEKEEKEEEKEEEKEEEEEKKEEEVEKKEEGEATNSTVPATKEH
PELQVEDTDADSGPLIPEETLPPPERPPPSPVKSDTLTVPGAAAAGHRKKLPSQDDEAEE
LKALSPAESPVVAWSDPTTPQEADGQDRAASTASQNSAIINDRLQELVKMFKERTEKVKE
KLIDPDVTSDEESPKPSPAKKAPEPDPAQKPAEAEVAEEEHYCDMLCCKFKRRPLKMYRF
PQSIDPLTNLMYILWLFFVVLAWNWNCWLIPVRWAFPYQRADNIHFWLLMDYLCDFIYLL
DITVFQMRLQFVKGGDIITDKKEMRNNYLKSRRFKMDLLCLLPLDFLYLKLGINPLLRLP
RCLKYMAFFEFNNRLEAILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAFQGIGSTHWV
YDGVGNSYIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVG
AATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKM
RLDLAIDVNYSIVSKVALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQA
GQVQVLGGPDGKAVLVTLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNE
ILVHYPESQKLLRKKARRMLRNNNKPKEEKSVLILPPRAGTPKLFNAALAAAGKMGPRGA
KGGKLAHLRARLKELAALEAAARQQQLLEQAKSSQEAGGEEGSGATDQPAPQEPPEPKDP
PKPPGPPEPSAQSSPPPASAKPEESTGEAAGPPEPSVRIRVSPGPDPGEQTLSVEVLEEK
KEGAE
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgttgggctgggtccaaagggtgctgcctcagcctccggggacccctcagaagaccgtg
gagacagcaggaccacagccagaaacagagtcgaaaccagaggccaacccacaaccggag
ccagaacctcagcaggaaccagagccagagccagagccagagccagagccagagccagag
ccagagccagagccagagccagagccagaacctgaacctgaaccagtacctgaagaggct
ccacctgaggtccaggccctgccaccagaggagccaatggaaggagagggagaggctgag
gctggtcccagccttcaagagacccaggtagctgaccctgctcagcccacctcccaggcc
caggttgctgttgccaaggtgaacaggcccagctcctggatgttgagctggttctggaga
ggcatgcagaaggtcgtgccacagcctgtctgcagcaatgggggccagaacctggctgcc
ggagagcgagacccagatcagggtggagcacagatcccagaaccttgtggcactggggac
ccaggatctgcagaagcttccgggactcaggacactgagcccagcctttggctgctcagg
tggcttgagcagaatctggaaaaagtgctgccccagccccctccgccttccctggcctgg
aaagttgaacctgaggctgctgtcttggatccagatcctccaggaacccctatgcagatg
gagcccacagagagcccctcccagcctaatcctggacccctggagcctgaggaagagcca
gctgcagagccccagcctggcttccaatcctcttccctgccaccacccggggaccccgtc
aggctgattgagtggctcctacacagactggagatggccctgcctcagcccgtgctccat
gggaaggctgcagagcaagagcctggctgccctgggatgtgtgacgtacagaccatcagc
atcctccccgtggaacaggtggaacatgatcttgtcctggaggaggtggactcttgctgg
gaggatgctcagcaggaagatggcgccagcccgcaggagacagaggtggctccagctcat
gaagaagagagtgaggccatagtggagatacccagggagctgacgaagattcaagaagaa
agagaagatgagcaggaagaggatgaggaagagaaggaggaagagaagaagaagggggag
gaagagaaggagaaggaggaggaagagaaagagaaagagaaggagaaggaggaggagaag
gaagaggaagagaaggaggaggaggaggaggaagaaaaggaagaggaagaggaggaaaag
gaagaagaggagaaggaagaggaggagaaggaagaggaggaagaagaagaggaggaggaa
gaagagcctattgtcctgctggatagctgtttggtggtgcaggctgatgtggacgagtgc
cagctagaaaggacaccgtcagagctagcatcgatccaggagctgccagaagagaaagag
gagaaggaagaggagaaggaggaggagaaagaggaggaggaggaaaagaaggaggaagaa
gtggagaagaaggaggaaggggaggccacaaactcaacagtaccagccacaaaggagcac
ccggagctccaggtagaagacacggatgctgatagtggccccctcatcccagaggagaca
ctccctccacctgagagaccaccaccgtctcctgtcaagtcggacaccctcacagttccc
ggcgccgctgcagcaggccacaggaagaagctaccttctcaggatgatgaggccgaagag
ctcaaggccctgtcaccagctgagtccccagtggttgcctggtcggaccccaccacccca
caggaggctgatggccaggaccgagcagcctccaccgccagccagaacagtgccatcatc
aatgaccggctccaggagctggtgaagatgttcaaggagcggacggagaaggtgaaggag
aagctcattgaccctgacgtcacctctgatgaggagagccccaagccctccccggccaag
aaggccccagaaccagacccagcccagaagccagcggaggcagaggtggcagaggaggaa
cactactgcgacatgctctgctgcaagttcaagcgcaggcccttgaagatgtaccggttc
ccccagagtatcgacccactgaccaacctcatgtacatcttgtggctgttctttgtggtg
ctggcctggaactggaactgctggctgatccctgtgcgctgggccttcccgtaccagcgg
gcagacaacatccacttctggctcctcatggattacttgtgcgacttcatctacctcctg
gacatcaccgtgttccagatgcgcctgcagtttgtcaaaggcggggacatcattacagac
aagaaggagatgcgtaataactacctgaagtctcgccggtttaagatggacctgctctgc
ctcctgcccttggactttctctacttgaaacttggcatcaaccctctccttcgcctgccc
cgctgcctgaagtacatggccttctttgagtttaataaccgcctggaagccatcctcagc
aaagcctacgtttacagagtcatcaggaccacggcctacctgctgtacagcctgcacctc
aactcctgcctttactactgggcatcagccttccagggcatcggctccactcactgggtt
tacgacggagtggggaacagttatattcgatgctactactgggctgtgaaaaccctcatc
accatcggaggactgcccgacccccagacgctctttgagattgtcttccagctgctgaac
tattttaccggggtctttgctttctctgtgatgattggacagatgagagatgtggtgggg
gccgccacagcggggcagacctactaccgcagctgcatggacagcacagtgaagtacatg
aacttctacaagatccccaggtctgtgcagaaccgtgtcaagacctggtatgagtacacc
tggcattcgcaaggcatgctggatgagtcagagctgatggtacaacttccggacaagatg
cgactggacctggccattgatgtgaactacagtattgtcagcaaagtggccctctttcag
ggctgtgaccggcagatgatcttcgacatgctcaagcggcttcgttctgttgtctaccta
cccaatgactatgtgtgcaagaagggggagattggccgagagatgtacattatccaggcg
gggcaggtgcaggtgctgggcggcccagatgggaaggctgtactggtgacactcaaagcc
ggatcggtgtttggagaaataagcttgctggctgtcgggggtggcaaccggcgcacagcc
aacgtggtggcccatggcttcaccaacctcttcatactggacaagaaggacttgaatgaa
attttagtgcattacccggaatctcagaagttacttcggaagaaggccaggcgcatgcta
agaaataacaacaaacccaaggaggaaaagagtgtgctcatcctgcccccgcgtgcgggc
accccgaagctcttcaatgctgccctggctgctgcaggaaagatgggccccaggggagcc
aagggcggcaagctcgcccacctgagagccaggctcaaggaactggctgcactggaggca
gccgcgcgacagcaacagctgctggaacaggccaagagctcgcaagaagctgggggagag
gagggctctggggccacagaccaacctgcaccccaggagccaccagagcccaaggaccct
ccgaagccaccagggccaccagagccctcagcccagagctctccacctccagcctcagca
aagcccgaggaaagcacgggggaggcagcagggcccccggagccctcggtgaggatccgt
gtgagtccaggccctgatcccggggagcagacactgtcggtggaggtgctggaggagaag
aaagagggggcggagtga

DBGET integrated database retrieval system