KEGG   Mus musculus (mouse): 12790Help
Entry
12790             CDS       T01002                                 

Gene name
Cnga3, CNG3
Definition
(RefSeq) cyclic nucleotide gated channel alpha 3
  KO
K04950  cyclic nucleotide gated channel alpha 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    12790 (Cnga3)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    12790 (Cnga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12790 (Cnga3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   12790 (Cnga3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CLZ cNMP_binding Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 12790
NCBI-ProteinID: NP_034048
MGI: 1341818
Ensembl: ENSMUSG00000026114
Vega: OTTMUSG00000024612
UniProt: Q9JJZ8
Position
1; 1 B
AA seq 631 aa AA seqDB search
MAKVNTQCSQPSPTQLSIKNADRDLDHVENGLGRVSRLIISIRAWASRHLHDEDQTPDSF
LDRFHGSELKEVSTRESNAQPNPGEQKPPDGGEGRKEEPIVVDPSSNIYYRWLTAIALPV
FYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRL
WKHYTKTLHFKLDILSLIPTDLAYLKLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPN
VFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPEYARLSRKYIYSLYWS
TLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDS
VKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKK
VRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFV
VLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALE
EKGRQILMKDNLIDEDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLK
QRLTRLESQMNRRCCGFSPDRENSEDASKTD
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtgaacacccagtgttcacagccctccccgacccaactttcaataaagaat
gcggacagagatctcgaccacgtagagaacggcctgggcagggtgtcacgcctcatcatc
tcgattcgtgcgtgggcctccaggcacttacacgatgaagaccagacacctgactccttt
ttggatcgatttcatggatctgagcttaaggaagtctccacccgggaaagcaatgcccag
cccaacccaggagaacagaagccaccagacggaggggaaggcaggaaggaggagcccatt
gtggtggacccctccagcaacatctactaccgctggctgactgccatcgcgctcccagtc
ttctataactggtgtctacttgtatgcagggcctgttttgatgagctacaatcagagcac
ctgacgctgtggctggtcttggactactctgcagatgtcctttatgttttagacatgctg
gttcgagcccggacaggtttccttgagcaaggcctaatggtcagagataccaagaggctg
tggaaacattacacaaagaccttgcacttcaagctggacatcctgtctctcatccccaca
gacctggcttatttaaagttgggcgtgaactacccagaactgaggttcaaccgcctcctg
aagttctctcggctctttgaattctttgaccgcacagagacaaggaccaactaccccaac
gtgttcaggatagggaacttggtcctttacacactcatcatcatccactggaatgcctgc
atctactttgccatttccaagttcattggttttgggacagactcctgggtctatccaaac
acctccaagccggagtatgcacgactctcccggaagtacatttacagtctctactggtcc
accctgaccctgaccaccattggtgagaccccaccccccgtgaaagatgaagagtatctc
tttgtggtcatcgacttcctggtgggtatcctgatctttgccaccatagtgggcaacgta
ggctccatgatttccaacatgaacgctccccgggtagagttccaggctaagatcgactcc
gtcaagcagtacatgcagttccggaaggtaaccaaggacttggagactcgggttatccgg
tggtttgactatctgtgggccaacaggaagacggtggatgaaaaggaagtgctcaaaaac
ctcccggacaagctgaaggctgagatcgccatcaacgtgcacctggacacgctgaagaag
gtccgaatcttccaggactgcgaggcggggctgctggtggagctggtgctgaagctccgc
cccactgtgttcagccccggggactacatatgcaaaaagggggacattggaagagagatg
tacatcatcaaggagggcaagctggctgtggtggctgatgacggggtcacccagtttgtg
gtcctcagtgacggcagttactttggggagattagcatcttaaacattaaggggagcaag
tctgggaaccgcaggacggccaacatcaggagtatcggctactcagacctgttctgcctc
tccaaggatgacctaatggaagccctcaccgagtacccagacgctaagagggctctggag
gaaaagggccgtcagattctgatgaaggacaacctaattgatgaggacctagtcgcggcc
agggtagataccagggacgttgaggagaaggtggagtacctggagtcgtccctggacatc
ctgcagacgaggtttgcccgactcctggctgagtacagtgcctcccagatgaagctgaaa
cagcggctcactcggctggagagccagatgaacaggaggtgttgtggcttctcacctgac
agggagaattccgaggatgcttcaaagactgactga

DBGET integrated database retrieval system