KEGG   Mus musculus (mouse): 12794Help
Entry
12794             CDS       T01002                                 

Gene name
Cnih2, CNIH-2, Cnil
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 2
  KO
K20368  protein cornichon
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12794 (Cnih2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    12794 (Cnih2)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    12794 (Cnih2)
Transporters [BR:mmu02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   12794 (Cnih2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 12794
NCBI-ProteinID: NP_034050
MGI: 1277225
Ensembl: ENSMUSG00000024873
UniProt: O35089 Q3SYI8
Position
19; 19 A
AA seq 160 aa AA seqDB search
MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERI
CCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAV
SIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaccttcgcagcattctgctacatgctcaccctggtgctgtgcgcctccctc
atcttctttgtcatctggcacatcatagcctttgatgagctgcggactgacttcaagaac
cccatcgaccaggggaacccagcgcgggcacgcgagcgtttgaaaaacatcgaacgcatc
tgctgcctcctgaggaagctggtggtcccggaatattccatccacggcctcttctgtctg
atgtttctgtgtgcagcagagtgggtgaccctgggcctcaacatccccctcctcttctac
cacctctggaggtacttccaccgtcctgcggatggctctgaggtcatgtatgatgcggtc
tctatcatgaatgctgacatcctcaactactgccagaaggagtcctggtgcaaactcgcc
ttctacctgctgtccttcttctattacctgtacagtatggtttatacgttggtgagcttc
taa

DBGET integrated database retrieval system