KEGG   Mus musculus (mouse): 12795
Entry
12795             CDS       T01002                                 

Symbol
Plk3, Cnk, Fnk, PLK-3, PRK
Name
(RefSeq) polo like kinase 3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    12795 (Plk3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    12795 (Plk3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12795 (Plk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12795 (Plk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12795 (Plk3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12795 (Plk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     12795 (Plk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   12795 (Plk3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Polo kinases
    12795 (Plk3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    12795 (Plk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr POLO_box Kinase-like Pkinase_fungal ABC1 APH
Other DBs
NCBI-GeneID: 12795
NCBI-ProteinID: NP_001300845
MGI: 109604
Ensembl: ENSMUSG00000028680
Vega: OTTMUSG00000009922
UniProt: Q6P571
Position
4:complement(116985852..116991244)
AA seq 631 aa
MEPAAGFLSPRPFPRAAAPSAPPAGPGPPANASPRSEPEVLAGPRAPDPPGRLITDPLSG
RTYTKGRLLGKGGFARCYEATDTESGIAYAVKVIPQSRVAKPHQREKILNEIELHRDLQH
RHIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQR
GILHRDLKLGNFFITDNMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGP
EADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASP
RDRPSIEQILRHDFFTKGYTPDRLPVSSCVTVPDLTPPNPARSLFAKVTKSLFGRKKNKN
KNHSEDQDNVSCLAPVVSGQAPASLVETAAEDSSPRGTLASSGDGFEEGLTVATVVESAL
CALRNCVAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQLSSRRVAVLFNDGTHM
ALSANRKTVHYNPTSTKHFSFSMGSVPRALQPQLGILRYFASYMEQHLMKGGDLPSVEEA
EVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEPLLVTFVARNRSACTY
LASHLRQLGCSPDLRQRLRYALRLLRDQSPA
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggagcccgccgccggcttcttgtctccgcgccccttcccgcgcgcggctgccccgtcc
gcgccccccgccggcccggggccgcctgccaatgcctccccgcgatcggaacctgaggtg
ctggccgggccacgggcgccggatcctcctggtcgcctcatcaccgaccctctcagcggc
cgtacctacaccaagggtcgcttgttgggcaaggggggcttcgcacgctgctatgaagcc
actgacaccgagtctggtatagcctacgcggtcaaagtcatcccacagagtcgcgtcgcc
aagccgcatcagcgcgagaagatcctaaatgagatagagttgcaccgagacctacagcac
cgccatatcgttcgcttttcacatcatttcgaggatgctgacaacatatacattttcctg
gagctctgtagccgaaagtccctggcccacatctggaaggcccgacacaccctgttggaa
ccagaggttcgctactacctgcgccagatcctttctggcctcaagtacttgcaccagagg
ggtatcttacacagagatctcaagctgggaaattttttcatcacggataacatggaactg
aaggtgggggattttgggctggcagctcgattagagcccccagagcagaggaaaaagacc
atctgtggcactcccaactacgtggctccagaagtgctgctgagacagggccatggcccc
gaggcagatgtgtggtcgcttggttgtgtcatgtacacgctcctgtgtgggagcccccca
tttgagactgctgacctgaaggagacataccgctgcatcaagcaggttcattacacgcta
cctgccagcctctccctgcctgcccggcagctcctggctgccatcctccgagcttcaccc
agagaccgcccttccattgaacagattttacgccatgacttctttacgaagggctacacc
cctgatcggctcccggtcagcagctgtgtgacagtcccagatctgacaccccccaaccct
gcgaggagtctgtttgccaaagttaccaagagcctgtttggcaggaaaaagaacaagaat
aagaaccattctgaggaccaggataatgtctcctgcttggctcctgtagtttcaggccag
gcccctgccagcttggtagagacagctgccgaggacagctcgccccgtgggacactggcc
agcagtggagatgggtttgaagaaggtttgactgtggccacagtggtagagtctgccctc
tgtgcactgagaaactgtgtggccttcatgcccccagccgaacagaacccagccccgctg
gcacagccagagcctctggtgtgggtcagcaagtgggttgactactccaacaagtttggc
tttggctatcagctgtccagccgccgtgtagccgtgctcttcaatgatggcacacacatg
gccctgtcagccaataggaagacggtgcactacaaccccaccagcacgaagcacttctcc
ttctccatgggttctgtgccccgagctctgcagcctcagctgggcatcctgcggtatttt
gcgtcctacatggaacagcacctcatgaagggtggagatctgcccagtgtggaagaggcg
gaggtgcctgccccacccttgctgctgcagtgggtcaagactgaccaggccctcctcatg
ctgttcagtgatggcactgtccaggtgaacttctacggggaccacacgaagctgatcctc
agtggctgggagcctctccttgtgaccttcgtggcccgcaatcgcagtgcttgtacttac
ctcgcttcccacctccggcagctgggctgctccccagacttgcggcagcgactgcgctac
gctctgcgcctgctcagggaccaaagccctgcttag

DBGET integrated database retrieval system