KEGG   Mus musculus (mouse): 12796
Entry
12796             CDS       T01002                                 

Gene name
Camp, C, CAP, CAP18, CLP, Cnlp, Cr, Cramp, FAL, FALL39, MC, MCLP
Definition
(RefSeq) cathelicidin antimicrobial peptide
  KO
K13916  cathelicidin antimicrobial peptide
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu04621  NOD-like receptor signaling pathway
mmu04970  Salivary secretion
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    12796 (Camp)
   04621 NOD-like receptor signaling pathway
    12796 (Camp)
  09154 Digestive system
   04970 Salivary secretion
    12796 (Camp)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    12796 (Camp)
   05152 Tuberculosis
    12796 (Camp)
SSDB
Motif
Pfam: Cathelicidins CAP18_C Cystatin Spp-24
Other DBs
NCBI-GeneID: 12796
NCBI-ProteinID: NP_034051
MGI: 108443
Ensembl: ENSMUSG00000038357
Vega: OTTMUSG00000020575
UniProt: P51437
Position
9 F2; 9 59.8 cM
AA seq 172 aa
MQFQRDVPSLWLWRSLSLLLLLGLGFSQTPSYRDAVLRAVDDFNQQSLDTNLYRLLDLDP
EPQGDEDPDTPKSVRFRVKETVCGKAERQLPEQCAFKEQGVVKQCMGAVTLNPAADSFDI
SCNEPGAQPFRFKKISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
NT seq 519 nt   +upstreamnt  +downstreamnt
atgcagttccagagggacgtcccctccctgtggctgtggcggtcactatcactgctgctg
ctactgggcctggggttctcccagacccccagctacagggatgctgtgctccgagctgtg
gatgacttcaaccagcagtccctagacaccaatctctaccgtctcctggacctggatcct
gagccccaaggggacgaggatccagatactcccaagtctgtgaggttccgagtgaaggag
actgtatgtggcaaggcagagcggcagctacctgagcaatgtgccttcaaggaacagggg
gtggtgaagcagtgtatgggggcagtcaccctgaacccggccgctgattcttttgacatc
agctgtaacgagcctggtgcacagccctttcggttcaagaaaatttcccggctggctgga
cttctccgcaaaggtggggagaagattggtgaaaagcttaagaaaattggccagaaaatt
aagaatttttttcagaaacttgtacctcagccagagtag

DBGET integrated database retrieval system