KEGG   Mus musculus (mouse): 12797
Entry
12797             CDS       T01002                                 

Gene name
Cnn1, C, CN, CnnI
Definition
(RefSeq) calponin 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Calponin CH CAMSAP_CH CDC24
Other DBs
NCBI-GeneID: 12797
NCBI-ProteinID: NP_034052
MGI: 104979
Ensembl: ENSMUSG00000001349
Vega: OTTMUSG00000062332
UniProt: Q08091 B2RSH3 Q8CBQ2
Position
9; 9 A3
AA seq 297 aa
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
CEFINKLQPGSVKKVNESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
QSTLLALASMAKTKGNKVNVGVKYAEKQERRFEPEKLREGRNIIGLQMGTNKFASQQGMT
AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLNPEYPELSEPTHNHHPHNYYNSA
NT seq 894 nt   +upstreamnt  +downstreamnt
atgtcttctgcacattttaaccgaggtcctgcctacggcttgtctgctgaagtaaagaac
aagctggcccagaaatacgaccatcagcgggagcaggagctgagagagtggattgagggg
gtgacaggccggcgcatcgggaacaacttcatggatggcctcaaagacgggatcattctt
tgcgaatttatcaacaagctgcagccgggttctgtgaagaaggtcaatgagtcaactcag
aactggcaccagctggagaacataggtaatttcatcaaagccattaccaagtatggggtg
aaaccccacgacatctttgaggccaacgacctgtttgaaaacaccaaccatacacaagtt
cagtccactctcctggctctggccagcatggccaagacaaaaggaaacaaagtcaatgtg
ggagtcaagtatgcagagaaacaagagcggagatttgagccggagaagttgagagaaggc
aggaacatcattggactgcagatgggcaccaacaagtttgccagtcagcagggcatgacg
gcctacggtacacggcgtcacctctatgatcccaaactgggtacagatcagcctctggac
caggcgaccatcagcctgcagatgggcaccaacaagggtgccagccaggctggcatgact
gcaccaggcaccaagcggcagatctttgagccaggtctgggcatggaacactgcgacaca
ctcaacgtcagcttgcagatgggcagcaacaagggggcctcccagaggggcatgacagtg
tatgggcttcctcgccaggtgtacgatcccaagtactgcctgaacccggagtacccagag
ctgagtgagcccacccacaatcaccacccgcacaactactacaactctgcctag

DBGET integrated database retrieval system