KEGG   Mus musculus (mouse): 12801Help
Entry
12801             CDS       T01002                                 

Gene name
Cnr1, CB-R, CB1, CB1A, CB1B, CB1R
Definition
(RefSeq) cannabinoid receptor 1 (brain)
  KO
K04277  cannabinoid receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04714  Thermogenesis
mmu04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    12801 (Cnr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12801 (Cnr1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    12801 (Cnr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    12801 (Cnr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12801 (Cnr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Cannabinoid
    12801 (Cnr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx YlaC
Motif
Other DBs
NCBI-GeneID: 12801
NCBI-ProteinID: NP_031752
MGI: 104615
Ensembl: ENSMUSG00000044288
Vega: OTTMUSG00000008304
UniProt: P47746 A0A385KNU8
Position
4 A5; 4 16.28 cM
AA seq 473 aa AA seqDB search
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgatcttagacggccttgcagataccaccttccgtaccatcaccacagacctc
ctctacgtgggctcaaatgacattcagtacgaagatatcaaaggagacatggcatccaaa
ttaggatacttcccacagaaattccctctaacttccttcaggggtagtcccttccaagaa
aagatgacggcaggagacaactccccgttggttccagcaggagacacaaccaacattaca
gagttctataacaagtctctctcatcgttcaaggagaacgaggacaacatccagtgtggg
gagaattttatggacatggagtgcttcatgattctgaatcccagccagcagctggccatc
gctgtcctgtccctcaccctgggcaccttcacggttctggagaacctgctggtgctatgt
gtcatccttcactcccgcagtctccgatgcaggccttcctaccacttcattggcagcctg
gcggtggccgatctcctgggaagtgtcatctttgtctacagctttgttgacttccacgtg
ttccaccgcaaagatagtcccaatgtgtttctgttcaaactgggtggggttaccgcctcc
ttcacagcatctgtgggcagcctgttcctcacggccatcgacaggtacatatccattcac
aggcctctggcctataagaggatcgtcaccaggcccaaggccgtagtggccttttgcttg
atgtggactattgcaatagtaattgctgtgttgcctctcctgggctggaactgcaagaag
ctgcaatctgtttgctcagacatcttcccactcattgatgaaacctacctgatgttctgg
atcggagtcaccagtgtgctgttgctgttcattgtgtatgcatacatgtacattctctgg
aaggctcacagccacgcagttcgcatgatccagcgtggaacccagaaaagcatcatcatt
cacacctcagaagatggcaaggtgcaggtgacacggcctgaccaagcccgcatggacatt
aggctggccaaaaccctggttctgatcctggtggtgttgatcatctgctggggccctctg
cttgcgatcatggtgtatgatgtctttgggaagatgaacaagcttatcaagacggtgttt
gccttctgtagtatgctctgcctgctgaactccaccgtgaaccccatcatctatgctctg
aggagcaaggacctgagacatgctttccgcagcatgttcccttcatgtgaaggcactgcg
cagcctctagataacagcatgggggactcagactgcctgcacaagcacgccaataacaca
gccagcatgcacagggccgcggaaagctgcatcaagagcactgttaagatcgccaaggtg
accatgtctgtgtccacagacacgtctgccgaggctctgtga

DBGET integrated database retrieval system