KEGG   Mus musculus (mouse): 12802Help
Entry
12802             CDS       T01002                                 

Gene name
Cnr2, CB-2, CB2, CB2-R
Definition
(RefSeq) cannabinoid receptor 2 (macrophage)
  KO
K04278  cannabinoid receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12802 (Cnr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12802 (Cnr2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Cannabinoid
    12802 (Cnr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 12802
NCBI-ProteinID: NP_001292207
MGI: 104650
Ensembl: ENSMUSG00000062585
Vega: OTTMUSG00000009846
UniProt: P47936
Position
4; 4 D3
AA seq 347 aa AA seqDB search
MEGCRETEVTNGSNGGLEFNPMKEYMILSSGQQIAVAVLCTLMGLLSALENMAVLYIILS
SRRLRRKPSYLFISSLAGADFLASVIFACNFVIFHVFHGVDSNAIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALCVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHRHVATLAEHQDRQVPGIARMRLD
VRLAKTLGLVLAVLLICWFPALALMGHSLVTTLSDQVKEAFAFCSMLCLVNSMVNPIIYA
LRSGEIRSAAQHCLIGWKKYLQGLGPEGKEEGPRSSVTETEADVKTT
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagggatgccgggagacagaagtgaccaacggctccaacggtggcttggagttcaac
cccatgaaggagtacatgatcctgagcagtggccagcagatcgccgtggcggtgctgtgc
accctgatggggctgctgagcgccctggagaacatggccgtgctctatattatcctgtcc
tcccggcggctccgcagaaagccctcgtacctgttcatcagcagcttggctggagctgac
ttcctggccagcgtgatcttcgcctgcaactttgtcatcttccacgtcttccacggggtc
gactccaacgctatcttcctgctgaagatcggcagtgtgaccatgaccttcacagcctct
gtgggcagcctgctgctaaccgctgttgaccgctacctatgtctgtgttacccgcctacc
tacaaagctctagtcacccgtgggagggcactggtggccctctgtgtcatgtgggtcctc
tcagcattgatttcttacctgccgctcatggggtggacttgttgccctagtccctgctct
gagcttttcccactgatccctaacgactacctactgggctggcttctattcattgccatc
ctcttttccggcatcatctatacctatgggtatgtcctctggaaagcccaccggcatgta
gccaccttggctgagcaccaggacaggcaggtgcctgggatagctcggatgcggctagac
gtgaggttggccaagactctgggcctggtgctggctgtgctgctcatatgctggttccct
gcactggctctcatgggccacagcctggtcaccacgctgagtgaccaggtcaaggaggcc
ttcgccttctgttccatgctgtgccttgttaactctatggtcaatcctatcatttacgcc
ctgcggagtggagagattcgctctgctgcccagcactgcctgataggctggaagaagtat
ctacagggcctcggacctgaggggaaagaagaaggcccaaggtcctcggttacagaaaca
gaggctgatgtgaaaaccacctag

DBGET integrated database retrieval system