KEGG   Mus musculus (mouse): 12803
Entry
12803             CDS       T01002                                 

Gene name
Cntf, AI429687
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12803 (Cntf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12803 (Cntf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12803 (Cntf)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   12803 (Cntf)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 12803
NCBI-ProteinID: NP_740756
MGI: 88439
Ensembl: ENSMUSG00000079415
Vega: OTTMUSG00000024775
UniProt: P51642 Q544D1
Position
19 A; 19 8.73 cM
AA seq 198 aa
MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVAS
TDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFA
YQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHHMGISAHESHYGAKQM
NT seq 597 nt   +upstreamnt  +downstreamnt
atggctttcgcagagcaatcacctctgacccttcaccgccgggacctctgtagccgctct
atctggctagcaaggaagattcgttcagacctgactgctcttatggaatcttatgtaaaa
catcaaggcctgaataaaaatatcagccttgactcagtggatggtgtaccagtggcaagc
actgatcgctggagtgagatgactgaggcagagcgactccaagagaacctccaggcttac
cgtaccttccaagggatgttaaccaagcttttagaagaccagagagtgcatttcaccccg
actgaaggtgacttccatcaggcaatacatactcttacgctccaagtttctgccttcgcc
taccagctagaggagttaatggcgcttctggaacagaaggtccctgaaaaagaggctgat
gggatgcctgtcacaattggagatggtggcctctttgagaagaagctgtggggcttgaag
gtccttcaagagctttcacagtggactgtgaggtctatccatgacctccgtgtcatttct
tctcatcacatgggaatctcagcacatgagagccattatggggccaagcaaatgtag

KEGG   Mus musculus (mouse): 12985
Entry
12985             CDS       T01002                                 

Gene name
Csf3, Csf, Csfg, G-CS, G-CSF, MGI-, MGI-IG
Definition
(RefSeq) colony stimulating factor 3 (granulocyte)
  KO
K05423  granulocyte colony-stimulating factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04657  IL-17 signaling pathway
mmu05144  Malaria
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12985 (Csf3)
   04151 PI3K-Akt signaling pathway
    12985 (Csf3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12985 (Csf3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12985 (Csf3)
   04657 IL-17 signaling pathway
    12985 (Csf3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12985 (Csf3)
  09174 Infectious disease: parasitic
   05144 Malaria
    12985 (Csf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12985 (Csf3)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   12985 (Csf3)
SSDB
Motif
Pfam: GCSF IL6 IL11
Other DBs
NCBI-GeneID: 12985
NCBI-ProteinID: NP_034101
MGI: 1339751
Ensembl: ENSMUSG00000038067
Vega: OTTMUSG00000006406
UniProt: P09920 Q0VB73
Position
11 D; 11 62.45 cM
AA seq 208 aa
MAQLSAQRRMKLMALQLLLWQSALWSGREAVPLVTVSALPPSLPLPRSFLLKSLEQVRKI
QASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCL
YQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAF
QRRAGGVLAISYLQGFLETARLALHHLA
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcaactttctgcccagaggcgcatgaagctaatggccctgcagctgctgctgtgg
caaagtgcactatggtcaggacgagaggccgttcccctggtcactgtcagcgctctgcca
ccatccctgcctctgccccgaagcttcctgcttaagtccctggagcaagtgaggaagatc
caggccagcggctcggtgctgctggagcagttgtgtgccacctacaagctgtgtcacccc
gaggagctggtgttgctgggccactctctggggatcccgaaggcttccctgagtggctgc
tctagccaggccctgcagcagacacagtgcctaagccagctccacagtgggctctgcctc
taccaaggtctcctgcaggctctatcgggtatttcccctgccctggcccccaccttggac
ttgcttcagctggatgttgccaactttgccaccaccatctggcagcagatggaaaaccta
ggggtggcccctactgtgcagcccacacagagcgccatgccagccttcacttctgccttc
cagcgccgggcaggaggtgtcctggccatttcgtacctgcagggcttcctggagacggct
cgccttgctctgcaccacttggcctag

KEGG   Mus musculus (mouse): 13856
Entry
13856             CDS       T01002                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    13856 (Epo)
   04066 HIF-1 signaling pathway
    13856 (Epo)
   04151 PI3K-Akt signaling pathway
    13856 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    13856 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    13856 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13856 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13856 (Epo)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   13856 (Epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 13856
NCBI-ProteinID: NP_031968
MGI: 95407
Ensembl: ENSMUSG00000029711
Vega: OTTMUSG00000021944
UniProt: P07321 Q0VED9
Position
5 G2; 5 76.5 cM
AA seq 192 aa
MGVPERPTLLLLLSLLLIPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPR
LSENITVPDTKVNFYAWKRMEVEEQAIEVWQGLSLLSEAILQAQALLANSSQPPETLQLH
IDKAISGLRSLTSLLRVLGAQKELMSPPDTTPPAPLRTLTVDTFCKLFRVYANFLRGKLK
LYTGEVCRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccaccctgctgcttttactctccttgctactgattcctctg
ggcctcccagtcctctgtgctcccccacgcctcatctgcgacagtcgagttctggagagg
tacatcttagaggccaaggaggcagaaaatgtcacgatgggttgtgcagaaggtcccaga
ctgagtgaaaatattacagtcccagataccaaagtcaacttctatgcttggaaaagaatg
gaggtggaagaacaggccatagaagtttggcaaggcctgtccctgctctcagaagccatc
ctgcaggcccaggccctgctagccaattcctcccagccaccagagacccttcagcttcat
atagacaaagccatcagtggtctacgtagcctcacttcactgcttcgggtactgggagct
cagaaggaattgatgtcgcctccagataccaccccacctgctccactccgaacactcaca
gtggatactttctgcaagctcttccgggtctacgccaacttcctccgggggaaactgaag
ctgtacacgggagaggtctgcaggagaggggacaggtga

KEGG   Mus musculus (mouse): 14599
Entry
14599             CDS       T01002                                 

Gene name
Gh, Gh1, Ghb1
Definition
(RefSeq) growth hormone
  KO
K05438  growth hormone
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    14599 (Gh)
   04151 PI3K-Akt signaling pathway
    14599 (Gh)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14599 (Gh)
   04060 Cytokine-cytokine receptor interaction
    14599 (Gh)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    14599 (Gh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14599 (Gh)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   14599 (Gh)
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 14599
NCBI-ProteinID: NP_032143
MGI: 95707
Ensembl: ENSMUSG00000020713
Vega: OTTMUSG00000003423
UniProt: P06880 A0A0M6L0K7
Position
11 E1; 11 68.89 cM
AA seq 216 aa
MATDSRTSWLLTVSLLCLLWPQEASAFPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERA
YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR
IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDAL
LKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctacagactctcggacctcctggctcctgaccgtcagcctgctctgcctgctctgg
cctcaggaggctagtgcttttcccgccatgcccttgtccagtctgttttctaatgctgtg
ctccgagcccagcacctgcaccagctggctgctgacacctacaaagagttcgagcgtgcc
tacattcccgagggacagcgctattccattcagaatgcccaggctgctttctgcttctca
gagaccatcccggcccccacaggcaaggaggaggcccagcagagaaccgacatggaattg
cttcgcttctcgctgctgctcatccagtcatggctggggcccgtgcagttcctcagcagg
attttcaccaacagcctgatgttcggcacctcggaccgtgtctatgagaaactgaaggac
ctggaagagggcatccaggctctgatgcaggagctggaagatggcagcccccgtgttggg
cagatcctcaagcaaacctatgacaagtttgacgccaacatgcgcagcgacgacgcgctg
ctcaaaaactatgggctgctctcctgcttcaagaaggacctgcacaaagcggagacctac
ctgcgggtcatgaagtgtcgccgctttgtggaaagcagctgtgccttctag

KEGG   Mus musculus (mouse): 16846
Entry
16846             CDS       T01002                                 

Gene name
Lep, ob, obese
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04152  AMPK signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16846 (Lep)
   04152 AMPK signaling pathway
    16846 (Lep)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    16846 (Lep)
   04060 Cytokine-cytokine receptor interaction
    16846 (Lep)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    16846 (Lep)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    16846 (Lep)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16846 (Lep)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   16846 (Lep)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 16846
NCBI-ProteinID: NP_032519
MGI: 104663
Ensembl: ENSMUSG00000059201
Vega: OTTMUSG00000035815
UniProt: P41160 Q544U0
Position
6 A3.3; 6 12.3 cM
AA seq 167 aa
MCWRPLCRFLWLWSYLSYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGL
DFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLP
QTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtgctggagacccctgtgtcggttcctgtggctttggtcctatctgtcttatgttcaa
gcagtgcctatccagaaagtccaggatgacaccaaaaccctcatcaagaccattgtcacc
aggatcaatgacatttcacacacgcagtcggtatccgccaagcagagggtcactggcttg
gacttcattcctgggcttcaccccattctgagtttgtccaagatggaccagactctggca
gtctatcaacaggtcctcaccagcctgccttcccaaaatgtgctgcagatagccaatgac
ctggagaatctccgagacctcctccatctgctggccttctccaagagctgctccctgcct
cagaccagtggcctgcagaagccagagagcctggatggcgtcctggaagcctcactctac
tccacagaggtggtggctttgagcaggctgcagggctctctgcaggacattcttcaacag
ttggatgttagccctgaatgctga

KEGG   Mus musculus (mouse): 19109
Entry
19109             CDS       T01002                                 

Gene name
Prl, AV290867, Gha1, Pr, Prl1a1
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    19109 (Prl)
   04151 PI3K-Akt signaling pathway
    19109 (Prl)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19109 (Prl)
   04060 Cytokine-cytokine receptor interaction
    19109 (Prl)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    19109 (Prl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    19109 (Prl)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   19109 (Prl)
SSDB
Motif
Pfam: Hormone_1 Noelin-1
Other DBs
NCBI-GeneID: 19109
NCBI-ProteinID: NP_001157002
MGI: 97762
Ensembl: ENSMUSG00000021342
Vega: OTTMUSG00000000731
UniProt: Q3TT66
Position
13 A3.1; 13 12.25 cM
AA seq 227 aa
MTMNSQGSAQKGTLLLLLISNLLFCQNVQPLPICSAGDCQTSLRELFDRVVILSHYIHTL
YTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSS
DPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQ
LPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaccatgaacagccaggggtcagcccagaaagggacactcctcctgttgctgatatca
aacctgctgttctgccaaaatgttcagcctctgccaatctgttccgctggtgactgccag
acttctctccgagagctgtttgaccgtgtggtcatactttctcactacatccataccctg
tatacagatatgttcattgaattcgataaacagtatgtgcaagaccgtgagtttatggtc
aaggtcatcaatgactgccccacttcttccctggctacacctgaagacaaggaacaagcc
ctgaaagtccctccggaagttcttctgaacctgatcctcagtttggtgcagtcctcgagt
gaccctctgtttcaactaataactggagtaggtggtattcaagaagcccccgaatacatc
ctatcaagagccaaagagattgaggaacaaaacaagcagcttcttgagggagttgagaag
ataattagccaggcctatcctgaagccaaaggaaatgggatctactttgtttggtcacaa
cttccatccctacagggagttgatgaagaatccaaaatcttgtctttgcgcaacaccatt
cgctgcctgcgcagggattcccacaaggttgacaattttctcaaggtcctgaggtgccaa
attgcccatcaaaacaactgctaa

KEGG   Mus musculus (mouse): 19111
Entry
19111             CDS       T01002                                 

Gene name
Prl6a1, Ghd10, P, PL, PLP-B, Prlpb
Definition
(RefSeq) prolactin family 6, subfamily a, member 1
  KO
K05439  prolactin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    19111 (Prl6a1)
   04151 PI3K-Akt signaling pathway
    19111 (Prl6a1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19111 (Prl6a1)
   04060 Cytokine-cytokine receptor interaction
    19111 (Prl6a1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    19111 (Prl6a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    19111 (Prl6a1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   19111 (Prl6a1)
SSDB
Motif
Pfam: Hormone_1 Rbsn
Other DBs
NCBI-GeneID: 19111
NCBI-ProteinID: NP_035296
MGI: 1206579
Ensembl: ENSMUSG00000069259
Vega: OTTMUSG00000000636
UniProt: O35257 A0A0M6L0L9
Position
13 A3.1; 13 12.39 cM
AA seq 230 aa
MLSLSQPCFSGTLLMLLASNFLLWKNVAPVPMYASLDEYGEMSIYDLLDHVTILSHNVSE
LTAEMHRIFMEDVRYKPGRWFSDRYLTACHTSTLTISVSKEGARQMPGVFLVKEMISMLT
AWRYPLYHIITELSYMEQAPDEIISRARNIEEKIIVLIEALRGILSKIQPGPPENERYPV
WNELASLQSPDEDLRHLTLFNLFQCLVKDSRKIDSSIRLLKCKLLYNRDC
NT seq 693 nt   +upstreamnt  +downstreamnt
atgctgtctttgagtcaaccttgcttctcagggactctcctgatgctgttggcatcaaac
ttccttctgtggaagaatgtggcccctgtgcccatgtatgccagtttggatgaatatggt
gagatgtccatatatgacctgcttgatcacgtcaccatactatctcataatgtcagtgag
ctcactgcagaaatgcacaggatatttatggaggatgtgcgatataaaccaggcaggtgg
ttctctgacagataccttactgcctgccacacatctacattgactatttcagtgtctaag
gagggagcccgacagatgccgggtgtattccttgtgaaagagatgatcagtatgttgaca
gcttggagatatcctctgtatcacataataactgaactgagttatatggagcaagctcca
gatgagatcatatcaagagccagaaatattgaagaaaaaatcatagtacttatagaagct
cttagagggatactcagcaagattcagcctggacccccagaaaatgagagatatcccgtg
tggaatgaactggcatccttgcagtcacctgatgaagaccttcgccatcttacattattt
aacttattccagtgcttggtcaaggattcacgtaagattgactctagtatcaggcttttg
aagtgcaaacttctctataacagagattgttaa

KEGG   Mus musculus (mouse): 21832
Entry
21832             CDS       T01002                                 

Gene name
Thpo, Mgdf, Ml, Mp, Mpllg, T, Tpo
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    21832 (Thpo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    21832 (Thpo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    21832 (Thpo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    21832 (Thpo)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   21832 (Thpo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 21832
NCBI-ProteinID: NP_001166976
MGI: 101875
Ensembl: ENSMUSG00000022847
Vega: OTTMUSG00000021017
UniProt: P40226 Q543R9
Position
16 B1; 16 12.51 cM
AA seq 356 aa
MELTDLLLAAMLLAVARLTLSSPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPV
LLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRL
LLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTT
AVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRS
PVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDISPGAFNKGSLAFNLQGGLPPSPSLA
PDGHTPFPPSPALPTTHGSPPQLHPLFPDPSTTMPNSTAPHPVTMYPHPRNLSQET
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggagctgactgatttgctcctggcggccatgcttcttgcagtggcaagactaactctg
tccagccccgtagctcctgcctgtgaccccagactcctaaataaactgctgcgtgactcc
cacctccttcacagccgactgagtcagtgtcccgacgtcgaccctttgtctatccctgtt
ctgctgcctgctgtggactttagcctgggagaatggaaaacccagacggaacagagcaag
gcacaggacattctaggggcagtgtcccttctactggagggagtgatggcagcacgagga
cagttggaaccctcctgcctctcatccctcctgggacagctttctgggcaggttcgcctc
ctcttgggggccctgcagggcctcctaggaacccagcttcctctacagggcaggaccaca
gctcacaaggaccccaatgccctcttcttgagcttgcaacaactgcttcggggaaaggtg
cgcttcctgcttctggtagaaggtcccaccctctgtgtcagacggaccctgccaaccaca
gctgtcccaagcagtacttctcaactcctcacactaaacaagttcccaaacaggacttct
ggattgttggagacgaacttcagtgtcacagccagaactgctggccctggacttctgagc
aggcttcagggattcagagtcaagattactcctggtcagctaaatcaaacctccaggtcc
ccagtccaaatctctggatacctgaacaggacacacggacctgtgaatggaactcatggg
ctctttgctggaacctcacttcagaccctggaagcctcagacatctcgcccggagctttc
aacaaaggctccctggcattcaacctccagggtggacttcctccttctccaagccttgct
cctgatggacacacacccttccctccttcacctgccttgcccaccacccatggatctcca
ccccagctccaccccctgtttcctgacccttccaccaccatgcctaactctaccgcccct
catccagtcacaatgtaccctcatcccaggaatttgtctcaggaaacatag

KEGG   Mus musculus (mouse): 28078
Entry
28078             CDS       T01002                                 

Gene name
Prl5a1, 1600013P04Rik, D13Wsu14, D13Wsu14e, Ghd24, P, PLP-L, Prlpl
Definition
(RefSeq) prolactin family 5, subfamily a, member 1
  KO
K05439  prolactin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    28078 (Prl5a1)
   04151 PI3K-Akt signaling pathway
    28078 (Prl5a1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    28078 (Prl5a1)
   04060 Cytokine-cytokine receptor interaction
    28078 (Prl5a1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    28078 (Prl5a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    28078 (Prl5a1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   28078 (Prl5a1)
SSDB
Motif
Pfam: Hormone_1 NPV_P10
Other DBs
NCBI-GeneID: 28078
NCBI-ProteinID: NP_076235
MGI: 106332
Ensembl: ENSMUSG00000017064
Vega: OTTMUSG00000000654
UniProt: Q9JII2 A0A0M6L0X8
Position
13 A3.1; 13 12.69 cM
AA seq 230 aa
MRLSKIQPHQSGTLLLLLLSNLLMWENVASVPRCIMEDGGCQKVLNYIFNMTSTISENFN
NLSSETLNDFDTEYDPHQKFQNRPTMTCHTSSRSVPNNKRKAERMRPVVLLNVTIRMLAA
WKNLLHHVENNMADLDGTPYVIISKVKLIDRQIKKLTKNLQNIKTILSQVNPDLKKNEDY
PAWSGEPYVQQSKRRVQLFGLHSLFFCLNNDAQKVSDFISILRDQIVPNQ
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcggctgtctaagattcaaccacaccaatcagggacacttctgctgctgctgctgtca
aacttgctcatgtgggagaatgtggcctctgtgcccagatgtatcatggaagatggaggt
tgccagaaggtcctcaactacatttttaacatgacaagcaccatatctgagaacttcaac
aacctttcttcagaaacattaaatgattttgatacagagtatgatccccaccagaaattc
cagaacaggcccaccatgacctgtcacacttcatcccgctctgtcccaaacaacaaaagg
aaggctgaaagaatgcggcctgtggtgcttctgaatgtgacaattagaatgctggctgcc
tggaaaaaccttctgcaccatgtagaaaacaacatggctgatctcgatggaactccttat
gttatcatatcaaaagttaagttgattgacagacaaatcaaaaaactcactaaaaatctg
cagaacattaagactatactcagccaggttaatcctgaccttaagaaaaatgaagactac
cctgcctggtcaggagagccatatgtacagcaatcaaaaaggagagttcaactttttggt
ttgcatagtttgtttttctgcttgaacaatgatgcacagaaggtttctgatttcatcagt
atcctgagagaccaaattgtgcctaatcaatga

DBGET integrated database retrieval system