KEGG   Mus musculus (mouse): 12804
Entry
12804             CDS       T01002                                 

Gene name
Cntfr, Cntfralpha
Definition
(RefSeq) ciliary neurotrophic factor receptor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    12804 (Cntfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12804 (Cntfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    12804 (Cntfr)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    12804 (Cntfr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  IL6/12 receptor family
   12804 (Cntfr)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  12804 (Cntfr)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_2 ig Ig_5
Other DBs
NCBI-GeneID: 12804
NCBI-ProteinID: NP_001129528
MGI: 99605
Ensembl: ENSMUSG00000028444
Vega: OTTMUSG00000006676
UniProt: O88507
Position
4 A5; 4 21.81 cM
AA seq 372 aa
MAASVPWACCAVLAAAAAAVYTQKHSPQEAPHVQYERLGADVTLPCGTASWDAAVTWRVN
GTDLAPDLLNGSQLILRSLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNTTAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAPETTTSTTSSLAPPPTTKICDPGELGSGGGPSILFLTSVPVTLVL
AAAAATANNLLI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgcttctgtcccatgggcctgctgtgctgtgcttgccgctgccgccgccgctgtc
tacacgcagaaacacagtccacaggaggcaccccacgtgcagtatgagcgtctgggcgca
gatgtgacgctgccgtgtgggacagcgagctgggacgcagctgtgacatggagggtaaac
gggacagatctggcccctgacctgctcaacggctctcagctgatactgcgaagcttagaa
ctgggccacagtggcctatacgcctgtttccaccgtgactcctggcacctgcgccaccaa
gtccttctacatgtgggtttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcacctgcccacccccacctacatccccaatacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacattcggtacatgcacctgttctcaaccatcaagtacaaggtctcc
ataagtgtcagcaacgccttgggtcacaacactacggccatcacctttgacgaattcacc
attgtgaagcctgatcctccagaaaacgtggtggcccggccagtgcccagcaacccccgt
cggctggaggtgacatggcagacaccctcaacttggcccgaccctgaatcctttcctctc
aagttcttcctgcgctaccggcctctcatcctggaccaatggcagcatgtggagctctcg
gatggcacagcacacaccatcacagatgcctacgcagggaaggaatacatcatccaggtg
gcagccaaggacaatgagattgggacatggagtgactggagcgtggctgctcacgccaca
ccctggactgaggaacctcggcatctcacaacagaagcccaggcccccgagaccacgacc
agcaccaccagctcattggcacccccacccaccacgaagatctgtgaccctggggagctt
ggcagcggcggaggaccctccatactcttcttgaccagtgtcccagtcactctggtcctg
gctgccgctgctgccacagccaacaatctcctgatctga

DBGET integrated database retrieval system