KEGG   Mus musculus (mouse): 12808
Entry
12808             CDS       T01002                                 

Gene name
Cobl
Definition
(RefSeq) cordon-bleu WH2 repeat
  KO
K18623  protein cordon-bleu
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    12808 (Cobl)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     12808 (Cobl)
SSDB
Motif
Pfam: Cobl WH2 RBD
Other DBs
NCBI-GeneID: 12808
NCBI-ProteinID: NP_766084
MGI: 105056
Ensembl: ENSMUSG00000020173
Vega: OTTMUSG00000005168
UniProt: Q5NBX1
Structure
PDB: 
5YPU 4JHD

Position
11 A1; 11 7.3 cM
AA seq 1337 aa
MDAPRALAAKPPTGRKMKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQN
STLDITVVLPSGLEKQSVVSGSHAMMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKP
NTLIGSLNVHTVLLKEKVPEERVKPGLTKAPEKSVRLVVNYLRTQKAVVRVSPEVPLQNI
LPVICAKCEVNPEHVILLRDNVAGEELELSKSLNELGIKELYAWDNRREMFRKSSLGNDE
TDKEKKKFLGFFKANKRSNSKAEHLGLSGADSDEDPAKSASGGDLNGCVTTPNSPSLHSR
SLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEKASLSSQADLQKKKRRA
PAPPPPQQPPPSPVVPNRKEDKEENRKSTVGVGRQVPQKPPRGTARGPPQLVLPPPPPYP
PPDTDVTEPVTFPGEGAGSETSELRPKLSLPLGPGSHCSMGGVSQVPAESEETASEDTTE
DSGVMSSPSDAISLDSQQDSMRSKDKWSTDQEDGSDQDLAGTPELGPQKSPSWGKSGSGS
SILRTEKATMPTNDDEDLFITGHLHQTLAELDEDLEGMEENYETDTSSLTNSVNGVSNHS
LQEAIIPDSGVDDIPVTFIGEVSDEPFDSGLFSSRCNNATTFNTGSIASQRSHLSPSQTE
HSQPFVRTSRKEPDPSPPSQDNRKRNQPTLANTSENENPVETDPTVTSLVSKLLIDDPKA
KDKGKVHGSSHSEKTQAGHGINSLRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGL
TTYKIVPPKSEMRCYDRDVSLSTGAIKIDELGNLVSPHMNGSRTISPPSAVVETDTPPIG
KVKEFWRRNSMEKYLNGPAECTIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQ
EYGAHLEEERSRPQSAVSCSVKVPASNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHA
DVVRPHKATTEQCHEEAKLARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPGVQL
PAGGHPKVEVNSTYGKSSTQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQ
KANSTSNFSQALDKAHPPPLLLAEARDSGRILMNGSARTPGNCEPPHSPKESTLTSYIIL
QTEEKPSSLSTDGQDADDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGRE
KLRKTAEQTSEGRPKKPSYVEAESERSALLAAIRGHSGTLSLRKVSSLASEELQSFRNAA
LGAPGLDKPQQEDLGLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQALMDA
IRSGTGAARLRKVPLLV
NT seq 4014 nt   +upstreamnt  +downstreamnt
atggacgcgccgcgtgcactggcggccaagccccccacaggaaggaagatgaaggcccgt
gctccgccacctcctggaaagcctgctgcccagaatgtccacagcgaacagaaactgccc
catgatgccaccctgggatcccagcaaagcctggtctacatgaaggaggcactgcagaac
agcaccttggacatcaccgtggttctgcccagtggactggagaagcagagtgtggttagt
gggagccacgcaatgatggacctactggttgaactctgccttcagaaccacctgaatcct
tctcaccacgtcctagagatctggtcttctgagacccaacagcctttgagttttaagcca
aatacgttgattgggtccttgaatgtgcatactgtacttctgaaagaaaaagtccctgaa
gaaagagttaaacctggcctaaccaaggctcctgagaaatctgtacgactggtagtgaac
tacctgagaacgcagaaggctgtcgtgcgggtgagccctgaggtgccactacagaatatt
ctgccagtcatctgtgcgaagtgtgaggtcaacccagaacacgtgattctgctcagagac
aatgttgccggggaggagctggagctgtccaagtccctgaatgaactagggatcaaggag
ctgtatgcgtgggacaacagaagagaaatgtttagaaaatcatcacttggcaatgatgag
acagacaaagagaagaaaaagtttctgggatttttcaaagctaataaaaggagcaacagt
aaggctgagcatcttgggctgtcaggtgcagatagtgatgaggacccggcgaagtcagca
tctggaggggacttgaacggctgcgtaacaacacccaactcaccatccttgcattctcgg
tccctaacactgggtccctccctctccctgggcaacatctctggagtgtctatgaagtca
gacatgaagaagcgcagagcccctcctcctccaagtcccaagctgctgggtcaagacaag
gtatcagaaaaggcctccctcagctcacaggctgatctccagaagaagaagaggcgggcg
ccagctcctcctccaccacagcagccaccaccaagtcctgtggtccccaaccgcaaggaa
gataaggaagagaacaggaagagcacagtgggtgttggacgtcaggtgccacaaaagcct
cccagaggcacagctcggggcccaccccagttagtgctccccccgcccccaccctaccct
cctcctgacacagatgtgacagagcctgtcacctttcctggggaaggcgctggttccgag
acctcagagctgagacccaaactgagtctgcctctggggcctggcagccactgcagcatg
ggtggagtctctcaggtgccagcggagagtgaggagacagcatctgaggacacaaccgag
gactcgggggtcatgagctctccctcagatgccatctccctggactcacaacaagacagc
atgagatccaaggacaaatggtccacagaccaggaagacggcagtgaccaggacctggct
ggaactccagaactgggtccccaaaagagcccatcatgggggaaaagtggttcaggaagc
tcaattctaaggactgagaaagccaccatgcctaccaatgatgatgaagacctattcatc
actggccacttacatcagaccctggcagaacttgatgaagacctggaaggaatggaagaa
aattatgaaacagatactagctctctaaccaactctgtcaatggtgtatccaaccacagt
ctgcaagaagccataatccctgatagtggcgtggatgacatcccagtcacttttatcggg
gaagtttctgatgagccttttgactcagggctgttctccagtagatgtaacaatgccact
acttttaacacggggagcattgctagccaaagatctcatctgtccccatctcagactgag
catagccagccattcgtaaggacaagtagaaaagagcctgatccctcccctccttcccaa
gataacaggaagagaaatcagccaaccttagccaacacatctgaaaatgagaatccagtt
gaaacagaccccacagttacatcacttgtttcaaagcttttaatagatgacccaaaagca
aaggataaaggcaaagtgcatggttctagtcacagtgagaagacacaggcaggtcatgga
ataaactcactgcgagtgaatccaagagatggtaaggatgagagctccaattcagcaccc
ccaccatggtctcatcatggccaggccttagggggaagctatggactcaagtatggcctc
acgacatataaaattgttcctcccaaatcagagatgaggtgttatgacagggatgtgtcc
ctctccactggtgccattaagattgatgaactagggaatctggtgagtcctcacatgaac
ggaagcaggaccatatccccaccatcagctgttgtcgaaacagacactccacctattgga
aaagtcaaagagttctggaggcgcaactcaatggaaaagtaccttaatgggccggctgag
tgcactatcaaaagggccccctccaccactatcactgccacaccagaaaaaccacagcaa
gataatgggatgaaggcagccttcacagtgaccactccccagcagcagcctgcctcacag
gaatatggggcacacctggaggaagagagaagccggccacagtcagcagtctcttgttct
gtgaaagtgccagcatctaatcccacagacatcacattcctcaagcctcaaagaagaaca
tccagccagtatgtggcctctgctattgccaagaagatggggcctccaaaagtccatgct
gatgtggtgagaccacataaggcaaccactgaacagtgtcatgaagaagcaaagctggct
agatctcctcccaccaggaaagatgatgcagctcccaacctacactcagaggcaaggcag
catgaacatgggacaaaccagagctctgtctgccttcccagcaaccctggtgtgcaattg
ccagcaggaggccatcccaaagtagaggtcaacagcacatatgggaagtcatcgactcaa
gactatcctgctgctgtccacagaaactcctatttcctcccaggcagatcttcccatagg
gatcgtgtttctgtgggacagagctgtggtttcaatgaaaagcaaactacaagtaaccaa
aaggcaaattcaacatctaacttctcgcaggcactggacaaggcgcatccaccccctctg
ctcttggcagaggcccgtgactctgggaggatactgatgaatggctctgcacgaacccca
ggaaattgtgagcccccccactctccaaaagaatccaccctgactagctatattatctta
cagacagaggaaaagcccagttcgttatctacagatggtcaagacgcagatgatactcta
ccgtccagcatttttgggccaaagaaaaagttcaagcctgtcattcaaaggccactccca
aaagatgtatccctgcacagtgccctgatggaagctatccactcatcaggagggagagaa
aagctccggaagactgcagaacagacgtcagaaggaaggccaaagaaaccatcctacgtg
gaggcagagagtgagcgatctgcccttctggcagccattcggggtcacagtgggactctc
agcctcaggaaggtgtcatcccttgcctctgaggagctccagagcttccgcaatgctgca
ctcggggctccaggtttggataaacctcagcaagaagaccttggccttccacccccacct
gccctgccaccaccacccgctccagccccccaggctccttcagcctccgtaacagtttct
aggttcagcaccggcacccccagcaactcagtgaatgctagacaagccttgatggatgcc
atccgctcgggcacaggagctgcaagactaagaaaggttcccttgctcgtgtga

DBGET integrated database retrieval system