KEGG   Mus musculus (house mouse): 12812
Entry
12812             CDS       T01002                                 
Symbol
Coil, Cln80, p80, p80-coilin
Name
(RefSeq) coilin
  KO
K13150  coilin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    12812 (Coil)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   Other proteins involved in snRNP biogenesis
    12812 (Coil)
SSDB
Motif
Pfam: Coilin_N
Other DBs
NCBI-GeneID: 12812
NCBI-ProteinID: NP_057915
MGI: 104842
Ensembl: ENSMUSG00000033983
UniProt: E9Q284
Position
11:88864761..88882439
AA seq 573 aa
MSKMAASETVRLRLQFDYPPPATPHCTVFWLLVDLNRCRVVTDLISLIRQRFGFSSGALL
GLYLEGGLLPPAESARLVRDNDSLRVKLEDQGLPENLIVSNGGDSSFPCRKAKKRAFKLM
EDEETDQGYKSLKKHCKRQEDSGQNEKASDLETKLLPDETGRTKSKKKSKVTGSPAEEDE
EETKKKSSKRKEKCEPKKQTRASKSSKQQTPKEGASQNCSFPRASPRSLGKARRRSSTGL
KGSSGHLSESESCPESVSDGHCSVMMQEVTFSEKLSAELLKDAPATKTAAANRQASKPGF
TFSSGKGKASRTSSSSSDSSSESEDQFLVSKNMLEGASAGFLKPTGLFAGQGGSGPGLSL
ETPGIMGWKSSDSNRGRQAPGPPSTPVPTSLGRGWGRGEDLLFGKGLRGRGVRGRGRGRG
QAVSCVFNRSSESQKQRQLNDILTNSSVVIQNPVEPPKKDYSLLPLLAAAPQVGEKIAFK
LLELTSDYSPDVSDYKEGKILSHDPETQQVDIEVLSSLPALKEPGKFDLVYHNENGTEVV
EYAVTQEKRITVLWRELIDPRLIIDSSGSISST
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgagcaagatggcagcctccgagacggttaggctacggcttcaatttgactacccgccg
ccggccactccacactgcacggtcttctggcttctggtggacctgaacagatgtcgagtt
gtcacggatctcatcagtctcatccgccagcgcttcggcttcagttccggggcgctcctg
ggcctctatctggaaggggggctgctgccccctgccgagagcgcgcgcctggtgagagac
aacgacagcctcagggttaagttagaagaccaaggactccctgagaacctgatagtaagc
aatggtggcgactctagtttcccatgcaggaaagcaaagaaacgggcttttaagttgatg
gaggatgaggaaacagatcagggatacaagtctttgaagaagcactgcaagaggcaggag
gacagcggccagaatgagaaggcctcggacctggaaactaaactcctcccagatgagacg
gggcggacaaagagcaagaaaaagagcaaagtgacaggcagcccagccgaagaggatgag
gaagagaccaaaaagaagtcttcaaaaagaaaggagaagtgtgaaccgaagaagcagacc
agggcctccaagtcttccaaacaacagacgcctaaagagggggcctcacagaactgcagc
ttccccagggcctcccccagaagcctcggtaaagcccgaaggagaagcagcacggggcta
aaaggtagctcaggccacctgtcagagtctgagtcctgcccagagtcagtcagcgatggc
cactgcagtgtcatgatgcaggaggtcaccttttcagagaaactgtcagctgagctgttg
aaagatgcacctgctaccaagactgcagctgccaacaggcaggcctcaaagcctggcttt
accttcagctccggcaagggcaaggcctccagaacctcgtcatccagttcagactccagt
tcagagtcggaagaccagttcctggtgtccaagaacatgctcgagggcgcatctgctggc
ttcttaaagccaactggcctctttgcagggcaagggggttctggtccagggctgtcattg
gagactccgggtattatgggatggaagtcttctgactcaaaccggggcagacaagctcct
ggtcctcccagtacgcctgtccccaccagtttgggaagaggatgggggcgaggagaggac
ttgttgtttgggaagggactgaggggccggggtgtccggggccgagggcgagggcgcggg
caagcggtctcctgtgtctttaatagaagctctgagagtcagaagcagagacagttaaat
gatattctaacaaactcatctgtggtgatccagaatccagtagagccccccaagaaggac
tatagtctattaccactgttggcagctgcccctcaagttggagaaaagattgcatttaag
cttttggaactcacatccgactactctcctgatgtctctgactacaaggaaggaaaaata
ttaagtcacgatccagagacccagcaagtggacatagaggtcctctcctcgctaccggct
ttgaaagaacctgggaagtttgatttggtctatcacaatgaaaatggaaccgaggtggtg
gaatacgctgtgactcaggagaagaggatcaccgtgctctggagagagttgatcgatccg
aggctgatcattgactcttcaggtagcatctcgagtacataa

DBGET integrated database retrieval system