KEGG   Mus musculus (mouse): 12815
Entry
12815             CDS       T01002                                 

Gene name
Col11a2
Definition
(RefSeq) collagen, type XI, alpha 2
  KO
K19721  collagen type V/XI/XXIV/XXVII, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12815 (Col11a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12815 (Col11a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   12815 (Col11a2)
SSDB
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Other DBs
NCBI-GeneID: 12815
NCBI-ProteinID: NP_001304651
MGI: 88447
Ensembl: ENSMUSG00000024330
Vega: OTTMUSG00000022512
UniProt: Q64739
Position
17 B1; 17 17.98 cM
AA seq 1715 aa
MERCSRCHRLLLFLPLVLGLSAAPGWAGAPSVDVLRALRFPSLPDGVRRSKGVCPGDVAY
RVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVQQLGLELGRPV
RFLYEDQRGRPQASAQPIFRGLSLADGKWHHVAVAVKGQSVTLIVDCKKRVTRPLPRSVH
PVLDTHGVVIFGAHILDDEVFEGDVQELLVVPGVQAAYQSCGQKDLECEREQRDGPQTQK
PHRAQRSPKKEPARLHKPQSQEPQKQPTESLYYDYEPPYYDVMTTGTAPDYQEQTDLQVS
PTADSFQAEEYGEGGTDSPAGFYDYTYGYGDDYREETELGPALSAETAHSGAVAHGPRGL
KGEKGEPAVLEPGMFVEGPPGPEGPAGLAGPPGIQGNPGPVGDPGERGPPGRAGLPGSDG
PPGPPGTSLMLPFRFGSSGGDKGPVVAAQEAQAQAILQQARLALRGPPGPMGYTGRPGPL
GQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRAGADGARGMPGEPGMKGDRGFD
GLPGLPGEKGQRGDTGAQGLPGPPGEDGERGDDGEIGPRGLPGESGPRGLLGPKGPPGIP
GPPGVRGMDGPHGPKGSLGPQGEPGPPGQQGTPGAQGLPGPQGAIGPHGEKGARGKPGLP
GMPGSDGLPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPRGVKGVDGIRGLKGHKGEKGED
GFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPTGDPGPTGLMGEKGKLGVPGLP
GYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGERGPTGPRGQRGPRGATGKSGAK
GTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPAGKDGLPGHPGQRGEVGFQGKTGPP
GPPGVVGPQGTAGESGPMGERGHSGPPGPPGEQGLPGTSGKEGTKGDPGPPGAPGKDGPA
GLRGFPGERGLPGTAGGPGLKGNEGPAGPPGPAGSPGERGAAGSGGPIGPPGRPGPQGPP
GAAGEKGVPGEKGPIGPTGRDGVQGPVGLPGPAGPPGVAGEDGDKGEVGDPGQKGTKGNK
GEHGPPGPPGPIGPVGQPGAAGADGEPGARGPQGHFGAKGDEGTRGFNGPPGPIGLQGLP
GPSGEKGETGDGGPMGPPGPPGPRGPAGPNGADGPQGSPGGVGNLGPPGEKGEPGESGSP
GVQGEPGVKGPRGERGEKGESGQAGEAGPPGPKGPTGDNGPKGNPGPVGFPGDPGPPGEA
GPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKRGPAGTPGPEGRQGEKGAKGDP
GAVGAPGKTGPVGPAGLAGKPGPDGLRGLPGSVGQQGRPGATGQAGPPGPVGPPGLPGLR
GDAGAKGEKGHPGLIGLIGPTGEQGEKGDRGLPGPQGSPGQKGETGIPGASGPIGPGGPP
GLPGPSGPKGAKGATGPAGPKGEKGVQGPPGHPGPPGEVIQPLPIQMPKKTRRSVDGSKL
IQDEEAVPTGGAPGSPAGLEEIFGSLDSLREEIEQMRRPAGTQDSPARTCQDLKLCHPEL
PDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDVTQFSYVDSEGSPVGVVQLTFLR
LLSVSAHQDVSYPCSGVSQDGPLKLRGANEDELSPETSPYVKEFRDGCQTQQGRTVLEVR
TPVLEQLPVLDASFADLGAPTRRGGVLLGPVCFMG
NT seq 5148 nt   +upstreamnt  +downstreamnt
atggagcggtgcagccgctgccaccgcctccttctgttcctacctctggtgctgggtctg
agcgctgccccgggatgggcaggtgctccctctgtggatgtgcttcgtgccctgaggttc
ccctcccttcccgatggtgttcggagatcaaaaggggtctgtccgggtgatgtggcttac
cgtgtggcacggcctgcccagctcagcgcacccacgcgccagctcttcccaggaggcttt
cccaaagacttctctctgctgacggttgtccggacccgccctggcctccaggctcccctc
ttgactctatacagcgcccagggagtccagcagctgggcttggagctcggccgccctgtc
cgctttctctatgaggaccagaggggacggccacaagcctccgctcagcccatcttccga
ggcctcagcctagcagatggcaaatggcaccacgtggctgtggctgtgaagggtcagtct
gtcactctcattgtggactgtaagaagcgagttacccggccccttcccagaagtgtgcat
ccggtgttggacacccacggggtggtgatctttggtgcccacatcctcgacgatgaagtc
tttgaaggcgatgttcaggagctcctcgttgtcccaggcgtccaagctgcctatcagtct
tgtgggcagaaggatctggaatgtgagagagaacagagggacggccctcagactcagaag
cctcacagagcccagagatctccaaagaaggaaccagcaagacttcataagccacagagc
caggagccccagaagcagcccactgagtctctctactatgactacgaacccccctattac
gatgtgatgactacggggacagcccctgattatcaggagcagacagatcttcaggtctcc
ccaacagctgacagtttccaggcagaggaatatggggagggaggcacagactccccagca
gggttctacgattacacctatggctatggggatgattatcgtgaggagaccgagcttggc
cctgccctctctgcggagacagctcactcaggagccgttgcccacggaccccgggggcta
aagggagagaagggagagcctgcagtgctggagcctggtatgtttgtagagggaccccca
ggcccagaaggcccagcgggattagctggaccccctggcatccaggggaacccaggcccg
gttggagaccccggtgagaggggcccccctggccgagcagggctccccggatcagatgga
ccccctggtcctcccggcacatctctgatgcttccattccggtttggcagtagtgggggt
gacaagggccccgtggtggcagcccaggaggcccaggcccaggcgattctgcagcaggca
cggctggcactccgtgggccccctggccccatgggttacacgggccgccctggaccattg
ggtcagcctgggagccctggcttgaagggagaatctggagatctgggcccacagggcccc
agaggacctcagggcctcacaggtcctcctggcaaggctggacgaaggggccgagcaggt
gctgatggagcccgtgggatgccgggagaacctggcatgaagggtgaccgaggtttcgac
ggacttccagggctacctggcgagaagggacaaaggggtgatacaggtgctcagggcctt
cctgggcctcctggtgaggacggagagaggggtgatgatggagagattgggccacggggg
ctgcctggagagtcgggacctagaggactccttggccctaaaggcccgcctggtattcct
gggccgccgggagtccgaggcatggacggtccccacggccccaaagggagcttgggacct
caaggagagccaggacctcctggacaacagggtactcctggggcccagggcctccccgga
cctcagggagccatcggtcctcatggagagaagggtgctcgtgggaaaccaggcctccct
ggcatgcctggatcagatggactcccgggtcacccagggaaggaaggtccccctggaacc
aaagggaaccagggcccgtccggaccacagggtcctctaggatacccaggccctcgaggc
gtcaagggtgtggatggaattcggggcctgaagggccacaagggtgaaaagggcgaggac
ggctttcctgggttcaaaggtgacataggagtgaaaggagacaggggcgaggttggagtc
cctggttccaggggcgaagacggccctgaagggccaaaagggcgcactggacctacagga
gaccctggacccactgggctcatgggcgagaagggcaagctaggtgttcctggtctgcct
ggctatcctggacgccagggccccaagggatctctgggtttccctggttttcctggagcc
agtggagagaagggagctcggggcctgtctgggaaatcaggacctcggggagaacggggc
cccacgggtccaaggggtcagcggggacctcgaggtgccactgggaaatctggagctaag
ggaacatcaggtggtgacggtccccacgggccacccggagagaggggtcttcctggacct
caaggccccaatggatttcctggccccaaaggccctccgggccctgcagggaaggatggg
ctgccgggacaccccggccagagaggagaagtgggattccaaggaaagaccggcccacca
ggcccgcccggagtggtgggacctcagggaacagctggagaaagtggtcccatgggagag
agaggtcactctggccccccaggacctcctggagagcaaggattgcctggaacatctggg
aaagaagggaccaagggtgaccctggtcctcctggggccccagggaaggatggtcctgct
ggtctgagaggcttcccaggagagcgaggccttccaggcactgctggtggacccggcttg
aaaggaaatgaaggtccagctggccctcctggccctgcaggctctcctggcgagcgaggt
gcagcaggatcagggggccccattggtcccccgggacgtccaggcccacaaggtccccct
ggagcagcaggagagaaaggcgtaccgggcgagaaaggccctattggtcccactggtcgt
gatggggtgcagggccccgtggggcttcctggtcctgcaggacccccaggcgtggctgga
gaggatggagacaagggtgaagtgggagaccctggacagaagggaaccaaaggaaacaag
ggtgaacatggccctcctggacctcctggtcccatcgggcctgtggggcaacctggagct
gcgggagctgatggtgagcctggagctcggggaccccagggacactttggagccaaaggt
gatgaaggaacaagagggttcaatggacccccgggacccatcggcctacagggcctgcca
ggaccctctggggagaaaggagaaacaggagacggggggcctatgggaccccctggccct
ccaggacctcgaggccccgctggacccaatggtgctgatggcccacaaggttcccctgga
ggtgttggaaacttgggtccccctggagaaaagggtgaaccgggggagtcagggtctcca
ggcgtccagggcgagccgggcgtcaagggaccacgtggagagcgtggtgagaaaggagag
tctgggcaggcgggagaggctggaccaccggggcccaaaggccctacaggcgacaatggc
cccaaggggaaccctggtcctgttggctttcctggggaccctggcccccctggagaagct
ggcccacggggccaggatggtgctaagggagaccgaggcgaggatggcgagccaggacaa
cctggatcccctggtcccaccggggagaatgggccccctggaccccttggaaagcgggga
cctgctggcactcctggtccagaaggacggcaaggagagaagggagctaagggggaccct
ggtgctgtgggggccccgggaaagacaggccctgtgggtcctgcaggcctagcaggaaag
cccggccccgatggtcttcgggggctcccgggttcagtgggtcagcaaggccgccctgga
gccacaggccaggctgggcccccaggtcctgtgggacccccagggcttcctggcctccgg
ggtgatgctggagccaagggggaaaagggtcacccaggtctcatcggactgattgggccg
actggagagcaaggcgagaagggcgaccgtggcctccctggacctcagggctcacccgga
cagaagggagagacgggtatcccaggagcatctggccccatcggtcctggagggcctcct
ggcctgcctggaccctctggccccaaaggagccaaaggagccacaggcccagctggaccc
aagggagagaagggtgtccagggccctccaggacacccgggccccccgggagaggtgatc
cagccactgcccatccagatgcccaagaagacccgccgttccgtggacggaagcaaactg
atacaggatgaggaggctgtgcccactggcggtgctccgggcagtcctgcggggctggag
gagatctttggctcactggactctctgcgggaggagatcgagcagatgaggaggccggcg
gggacccaggacagccctgctcgcacctgccaggacttgaagctgtgccacccggagctt
cctgatggagagtactgggttgaccctaaccagggctgtgctcgggatgccttccgggtg
ttctgcaacttcacagcaggaggggagacgtgtgtcacacccagggatgacgtcacacag
ttctcctacgtggactccgagggctccccagtgggcgtggtccagctcaccttcctgcgg
ctgctcagcgtctctgcccaccaggatgtctcctacccttgctctggagtatcccaggat
ggtcccctgaaactccgaggggccaacgaggatgagctgagccctgagaccagcccttat
gtcaaggagttcagagatggctgtcagacccagcaaggccggacggtgttggaggtgcgc
acgcctgtactggagcagctgcccgtgctggatgcctccttcgcagacctgggggccccc
acaagacggggaggggtgcttctggggcctgtctgcttcatgggctag

DBGET integrated database retrieval system